SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g01490

Feature Type:gene_model
Chromosome:Gm19
Start:1111660
stop:1112725
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g01490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40190AT Annotation by Michelle Graham. TAIR10: RNA ligase/cyclic nucleotide phosphodiesterase family protein | chr5:16069298-16069849 REVERSE LENGTH=183 SoyBaseE_val: 2.00E-78ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0016070GO-bp Annotation by Michelle Graham. GO Biological Process: RNA metabolic process SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
UniRef100_B9RUD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin binding protein, putative n=1 Tax=Ricinus communis RepID=B9RUD3_RICCO SoyBaseE_val: 6.00E-93ISS
UniRef100_I1N5V9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N5V9_SOYBN SoyBaseE_val: 4.00E-132ISS

Expression Patterns of Glyma19g01490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g01490
ParalogEvidenceComments
Glyma13g04420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g01490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g011900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g01490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g01490
>Glyma19g01490.1   sequence type=CDS   gene model=Glyma19g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCGCAGCAATTAGGGTTCGCGATCGAGCTATACCTAGACCCTGCGTTGGAGAATCAGGTTCTGAAAGCATGGAACGTTCTTGCGAGAAGACAAATCAGCACGCACCTGATAGAAATGGAGTCTCGGCCACACATAACCCTATTCTCGGCGCCATTTCTAGAACCTTCGAAGCTCGAATCTCTCCTGAAAGGCTTCGCATCGAAGCACGATCCTCTCCCTCTCACCTTCTCTTCCCTCGCCACTTTCCCCAACGACCCCGACAACCTCCTCTTCCTCGCCCCAACCCCTTCCCTCTCACTCCTCCACCTTCAGTCACAGCTCTGTGACGCTATCAGAAAAGAAGGCCTCGAAATCGGTGACGATTACGCTTTCAATTCCTGGATCCCTTATTGCTCCGTTGCACACCATGTCCCCAAAAACAGAATGCCTGAGGCTTTCTCCCTCTTGAGGGAACTCAAGCTTCCGGTTTCCGGTTACGCCATGGATATCGCTCTCGTTCAGTTCTCTCCGGTTCGGGAAATCTTCTCGTTTGTGCTCGGCAACAACGTAGACTCCTGA
Predicted protein sequences of Glyma19g01490
>Glyma19g01490.1   sequence type=predicted peptide   gene model=Glyma19g01490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSQQLGFAIELYLDPALENQVLKAWNVLARRQISTHLIEMESRPHITLFSAPFLEPSKLESLLKGFASKHDPLPLTFSSLATFPNDPDNLLFLAPTPSLSLLHLQSQLCDAIRKEGLEIGDDYAFNSWIPYCSVAHHVPKNRMPEAFSLLRELKLPVSGYAMDIALVQFSPVREIFSFVLGNNVDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo