Report for Sequence Feature Glyma19g01341
Feature Type: gene_model
Chromosome: Gm19
Start: 969663
stop: 970040
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma19g01341
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G48030 AT
Annotation by Michelle Graham. TAIR10: hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein | chr3:17725410-17727954 REVERSE LENGTH=349
SoyBase E_val: 5.00E-14 ISS
GO:0001666 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to hypoxia
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR22765 Panther
RING FINGER AND PROTEASE ASSOCIATED DOMAIN-CONTAINING
JGI ISS
PTHR22765:SF20 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00097 PFAM
Zinc finger, C3HC4 type (RING finger)
JGI ISS
UniRef100_B9RUA7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9RUA7_RICCO
SoyBase E_val: 8.00E-41 ISS
UniRef100_I1N5T8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5T8_SOYBN
SoyBase E_val: 4.00E-88 ISS
Expression Patterns of Glyma19g01341
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma19g01341
Paralog Evidence Comments
Glyma13g23930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma19g01341 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma19g01341
Coding sequences of Glyma19g01341
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma19g01341.1 sequence type=CDS gene model=Glyma19g01341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACAGTTATTGTAACAGTGGTGTTAATATTTGTTGGATTTGTGTTCCTGGTCCTACTTCATGTTTGTTTTTCCGAGAGAGCTAGGAGAGGATCAATGGTTGAGAGGAGAGCAAATGGGGGAAGAAGCATGTCTATAGATGACTTGGAGAAGCTTCCATGTTATGATTATGTTGACAATTCCAAAGGCAACAACACAAGCAGCCCTGTGGATTGTGCAGTTTGCTTGGAGAACCTAATCACAGGAGATAAGTGCAGATTCTTACCTGTGTGCAAGCATAGTTTTCATGCCCAATGTGTGGACGCATGGCTTCTAAAGACACCCATTTGTCCAACTTGCAGGTGTAATGCTCATTCTCATAGTGGAAACCAAGTTGTA
Predicted protein sequences of Glyma19g01341
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma19g01341.1 sequence type=predicted peptide gene model=Glyma19g01341 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTVIVTVVLIFVGFVFLVLLHVCFSERARRGSMVERRANGGRSMSIDDLEKLPCYDYVDNSKGNNTSSPVDCAVCLENLITGDKCRFLPVCKHSFHAQCVDAWLLKTPICPTCRCNAHSHSGNQVV