SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g01300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g01300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g01300

Feature Type:gene_model
Chromosome:Gm19
Start:921026
stop:924804
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01470AT Annotation by Michelle Graham. TAIR10: homeobox 1 | chr3:182648-184034 REVERSE LENGTH=272 SoyBaseE_val: 4.00E-93ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0015996GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll catabolic process SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000976GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0042803GO-mf Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG0483 KOG Transcription factor HEX, contains HOX and HALZ domains JGI ISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF218Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
PF02183PFAM Homeobox associated leucine zipper JGI ISS
UniRef100_B3IX27UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor Homeobox n=1 Tax=Lotus japonicus RepID=B3IX27_LOTJA SoyBaseE_val: 7.00E-151ISS
UniRef100_C6T8D2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T8D2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g01300 not represented in the dataset

Glyma19g01300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g23890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g010100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g01300.1   sequence type=CDS   gene model=Glyma19g01300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTCTGGACGGATTTTCTTTGGTGCCTCTGCTTCAAGCGGCAACAACATGCTCTTTCTCGGCAACACTGAACTTGCTTTTCGAGGGAGATCGATTATGAGCATGGAGGAAGCCTCGAAGAGGCGACCTTTCTTCACCTCACCGGATGAACTGTATGATGAAGAGTATTATGAGAAGCAGTCGCCGGAGAAGAAGCACCGCCTCAGTTCCGAACAGGTCCATCTGTTGGAGAAGAGCTTTGAGGAAGAGAACAAATTGGAGCCTGAGAGGAAGACCCAGTTGGCTAAGAAGCTGGGATTGCAGCCCAGGCAGGTGGCTGTGTGGTTTCAGAACCGCAGGGCTCGATGGAAGACCAAGCAACTTGAAAGGGATTATGATGTTCTCAAGTCTTCATACGATACCCTACTTTCATCCTATGATTCAATTATGAAGGAGAATGAGAAACTCAAATCTGAGGTGGTATCCTTAAATGAAAAGCTTCAAGTTCAAGCTAAAGAGGTGCCTGAGGAACCATTATGTGACAAGAAAGTTGATCCAATTCCAGTAGATGAAGATATGGCTCCGATTTTCGGCACAAGGGTGGAGGACCACCTGAGTAGTGGGAGTGTTGGAAGTGCGGTGGTGGATGAGGGTAGTCCACAGGTGGTTGTTGACAGTGTTGATTCATACATTCTAGCTGACAACTATGGTGGATGTGTGGGCCCGGTCGAGAGGGTTCAGTCGGAGGAGGAGGATGGGAGTGATGATGGGAGGAGTTACTTGGATGTGTTTGTGGTATCTGAAACTGAGCACCAAAACCATGAGGAAGGAGAGACATTGGGTTGGTGGACTAATATGTATTATGTTGGATAA

>Glyma19g01300.1   sequence type=predicted peptide   gene model=Glyma19g01300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESGRIFFGASASSGNNMLFLGNTELAFRGRSIMSMEEASKRRPFFTSPDELYDEEYYEKQSPEKKHRLSSEQVHLLEKSFEEENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDVLKSSYDTLLSSYDSIMKENEKLKSEVVSLNEKLQVQAKEVPEEPLCDKKVDPIPVDEDMAPIFGTRVEDHLSSGSVGSAVVDEGSPQVVVDSVDSYILADNYGGCVGPVERVQSEEEDGSDDGRSYLDVFVVSETEHQNHEEGETLGWWTNMYYVG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo