SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G01480 | AT | Annotation by Michelle Graham. TAIR10: cyclophilin 38 | chr3:188569-190674 FORWARD LENGTH=437 | SoyBase | E_val: 0 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009595 | GO-bp | Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus | SoyBase | N/A | ISS |
| GO:0009657 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plastid organization | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
| GO:0009814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response, incompatible interaction | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast relocation | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0010103 | GO-bp | Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis | SoyBase | N/A | ISS |
| GO:0010200 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to chitin | SoyBase | N/A | ISS |
| GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
| GO:0010310 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0016117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0035304 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation | SoyBase | N/A | ISS |
| GO:0042549 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II stabilization | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0042793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter | SoyBase | N/A | ISS |
| GO:0043900 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
| GO:0009543 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0031977 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen | SoyBase | N/A | ISS |
| GO:0003755 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity | SoyBase | N/A | ISS |
| KOG0881 | KOG | Cyclophilin type peptidyl-prolyl cis-trans isomerase | JGI | ISS | |
| PTHR11071 | Panther | CYCLOPHILIN | JGI | ISS | |
| PTHR11071:SF75 | Panther | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE | JGI | ISS | |
| PF00160 | PFAM | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | JGI | ISS | |
| UniRef100_I1N5T2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5T2_SOYBN | SoyBase | E_val: 0 | ISS |
| UniRef100_O22636 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Poly(A) polymerase n=1 Tax=Pisum sativum RepID=O22636_PEA | SoyBase | E_val: 0 | ISS |
|
Glyma19g01260 not represented in the dataset |
Glyma19g01260 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma13g23850 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g009700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g01260.1 sequence type=CDS gene model=Glyma19g01260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGCCATCATCCCCTGCCACTACTGTGCTTCCCTCAGTCCCAAATGGTTCAATTCCAACAACACACATTCTAGGCGTTTATCGTACCCACTTCGAGGACTCCGAGGTTTCAATGCTCGTTGCTCTTACCAACCACCCCATCATTCTGAATCTCAGAACAACCATAATGGGAGGTCATTTTCCTTGAAGCAGTGTGCGATATCTATTGCACTGGCAGTTGGGTTAATAACAGGAGTTCCTACATTGGATGGTCCCACCATTGCCCAAGCAGCTAATCCTGTGTTGTCTGATCTCTCTGTTTTGATTTCCGGACCACCGATTAAGGATCCTGGGGCATTGTTGAGATATGCTCTTCCTATTGACAATAAGGCCATTAGAGAAGTGCAAAAGCCACTTGAAGATATCACGGAGAGTCTCAAGATTGCTGGAGTCAAGGCACTTGACTCTGTCGAAAGAAATGTGAGGCAGGCGTCTCGAACTCTCAAGCAAGGAAAGACTTTAATTGTATCCGGTTTAGCTGAATCAAAGAAAGAACATGGCGTTGAACTGCTTAGTAAGCTGGAAGCTGGTATAGATGAGCTTGAACTGATAATACAGGATAGGAATCGAGATGCAGTTGCACCAAAACAGAAAGAGCTTCTTCAGTATGTTGGAGGTGTTGAAGAAGACATTGTTGATGGCTTCCCATTTGAAGTGCCCGAGGAATACCAAAATATGCCTTTATTGAAGGGGAGAGCAGCAGTGGATATGAAAGTCAAGGTTAAAGACAATCCAAACCTGGATGAATGTGTTTTCCACATCGTTCTTGATGGTTATAATGCCCCTGTAACTGCTGGAAATTTTGTTGATTTGGTAGAAAGGCACTTCTATGATGGCATGGAAATCCAAAGAGCGGATGGGTTTGTTGTCCAAACTGGTGATCCTGAAGGTCCTGCTGAGGGTTTTATTGATCCAAGTACAGAGAAAATCAGGACAATACCATTAGAAATTACGGTGAATGGAGAAAAGGCACCTGTTTATGGATCAACTTTAGAGGAGCTTGGTCTATACAAGGCTCAAACAAAGCTTCCGTTTAATGCTTTCGGTACAATGGCAATGGCAAGAGATGAATTTGAGGACAACTCTGCCTCTAGCCAGATATTTTGGCTATTGAAAGAAAGTGAGCTAACTCCTAGTAATGCCAATATATTGGATGGTCGATATGCCGTCTTTGGCTATGTAACAGAAAATGAGGATAACTTGGCAGATCTCAAAGTTGGTGATGTCATAGAATCCATTAAAGTAGTTTCTGGCCTGGATAATTTGGTGAATCCCACCTACAAGATTGCTGGCTAG
>Glyma19g01260.1 sequence type=predicted peptide gene model=Glyma19g01260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAAIIPCHYCASLSPKWFNSNNTHSRRLSYPLRGLRGFNARCSYQPPHHSESQNNHNGRSFSLKQCAISIALAVGLITGVPTLDGPTIAQAANPVLSDLSVLISGPPIKDPGALLRYALPIDNKAIREVQKPLEDITESLKIAGVKALDSVERNVRQASRTLKQGKTLIVSGLAESKKEHGVELLSKLEAGIDELELIIQDRNRDAVAPKQKELLQYVGGVEEDIVDGFPFEVPEEYQNMPLLKGRAAVDMKVKVKDNPNLDECVFHIVLDGYNAPVTAGNFVDLVERHFYDGMEIQRADGFVVQTGDPEGPAEGFIDPSTEKIRTIPLEITVNGEKAPVYGSTLEELGLYKAQTKLPFNAFGTMAMARDEFEDNSASSQIFWLLKESELTPSNANILDGRYAVFGYVTENEDNLADLKVGDVIESIKVVSGLDNLVNPTYKIAG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
