Glyma19g01180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g01180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g01180): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g01180

Feature Type:	gene_model
Chromosome:	Gm19
Start:	816223
stop:	817923
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g01180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36330	AT	Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0497) \| chr2:15233620-15235298 FORWARD LENGTH=283	SoyBase	E_val: 9.00E-28	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF04535	PFAM	Domain of unknown function (DUF588)	JGI		ISS
UniRef100_D2DWA8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MtN24-like protein n=1 Tax=Phaseolus vulgaris RepID=D2DWA8_PHAVU	SoyBase	E_val: 5.00E-41	ISS
UniRef100_UPI000233F311	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F311 related cluster n=1 Tax=unknown RepID=UPI000233F311	SoyBase	E_val: 5.00E-102	ISS

Expression Patterns of Glyma19g01180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g01180 not represented in the dataset	Glyma19g01180 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g01180

Paralog	Evidence	Comments
Glyma13g23770	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g01180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g008800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g01180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g01180

Limit To All Plant Sequences

>Glyma19g01180.2   sequence type=CDS   gene model=Glyma19g01180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGAAAAAAGTGCGTAGAGGGTCATCAACAAACAAATGGTATGGTTTCTACTCGGATTCATCATCATCTTCGTCTCAACATTCTCAAACACATCGGTATGACTACGAGGAATTCAAGTACTTCTTATCAGTGAATATAATAGGGTTCGTGTATTCTGGATTGCAAATATGTGATATAGTGAAGTACATGATTACTAAAAGACACACAATGGACCCCAAGCTTCGGGTTTACTTCAACTTTGCTATGGATCAGGTCTTGGCATATCTTCTAATGTCAGCATCATCTTCAGCTGCCACCACAACCTATTATTGGACAAATAGTGCTTCAGCTGCAGACAAGTACGTGGAAATGGCAAAAGCATCTGTTGCGTTATCCTTCGTTGCATTTGTGGCATTTGCCTCTTCCTCTGTTGTTTCTGCTTTCATTTTTTGTAGATTCAACTAG

Predicted protein sequences of Glyma19g01180

Limit To All Plant Sequences

>Glyma19g01180.2   sequence type=predicted peptide   gene model=Glyma19g01180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EKKVRRGSSTNKWYGFYSDSSSSSSQHSQTHRYDYEEFKYFLSVNIIGFVYSGLQICDIVKYMITKRHTMDPKLRVYFNFAMDQVLAYLLMSASSSAATTTYYWTNSASAADKYVEMAKASVALSFVAFVAFASSSVVSAFIFCRFN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain