|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G23740 | AT | Annotation by Michelle Graham. TAIR10: Oxidoreductase, zinc-binding dehydrogenase family protein | chr1:8398245-8399656 REVERSE LENGTH=386 | SoyBase | E_val: 4.00E-41 | ISS |
| GO:0000096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process | SoyBase | N/A | ISS |
| GO:0006546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycine catabolic process | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0006733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process | SoyBase | N/A | ISS |
| GO:0006766 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process | SoyBase | N/A | ISS |
| GO:0008652 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process | SoyBase | N/A | ISS |
| GO:0009106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process | SoyBase | N/A | ISS |
| GO:0009108 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process | SoyBase | N/A | ISS |
| GO:0009117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009416 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to light stimulus | SoyBase | N/A | ISS |
| GO:0009695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010264 | GO-bp | Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process | SoyBase | N/A | ISS |
| GO:0015994 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process | SoyBase | N/A | ISS |
| GO:0015995 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process | SoyBase | N/A | ISS |
| GO:0016117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0019216 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019748 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary metabolic process | SoyBase | N/A | ISS |
| GO:0031408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0044272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009579 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: thylakoid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS |
| GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0035671 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: enone reductase activity | SoyBase | N/A | ISS |
| GO:0035798 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 2-alkenal reductase (NADP+) activity | SoyBase | N/A | ISS |
| UniRef100_G7KKH6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Quinone oxidoreductase-like protein n=1 Tax=Medicago truncatula RepID=G7KKH6_MEDTR | SoyBase | E_val: 1.00E-47 | ISS |
| UniRef100_G7KKH6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Quinone oxidoreductase-like protein n=1 Tax=Medicago truncatula RepID=G7KKH6_MEDTR | SoyBase | E_val: 1.00E-47 | ISS |
|
Glyma19g01131 not represented in the dataset |
Glyma19g01131 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.19g008400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma19g01131.1 sequence type=CDS gene model=Glyma19g01131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTAACGGGCAAATCTATACTTGTTCTAGGGGGTGCTGGTAGATTTGGATCGTTTGTCATCCAGATAGTCGAAGTATTTGAAATTAACTATAATATTCTTTCCCACCTAAACCCCACAACAACAATATTTAAGCGTGACTCAAACAATTTGAAAAACTCGCCAAGCACGTTTTTGGCGCATCTAAGGTTGCAGCTACTGCTAAGGAACTTGGGAGTAGACATTCAAATTGATTACACAAAGGAGAATTTTGAAGAGCTTGCAGAGAAGTCTGATGTAGTGTACAGTAGGCTATCAAAGAAGAGGGGGAAAGTTGTGACAATAGCACCACCTTCGATTCCACCTGCTATGCCGTTCATTATCACTTCAGATGGTGTTGTGTTGGAGAAGTTAAAGCCTTACTTAGAGAGTGGGAAGGTGAAGCCAATATTGGGTCCTAAGAGTCCCTTTCCATTTTCTCAGACAGCGGAAGCATTTGCATACTTGAATACTAATAGAGCCATTGGAAAAGTAGTCATACATCCCATTCCATAA
>Glyma19g01131.1 sequence type=predicted peptide gene model=Glyma19g01131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLTGKSILVLGGAGRFGSFVIQIVEVFEINYNILSHLNPTTTIFKRDSNNLKNSPSTFLAHLRLQLLLRNLGVDIQIDYTKENFEELAEKSDVVYSRLSKKRGKVVTIAPPSIPPAMPFIITSDGVVLEKLKPYLESGKVKPILGPKSPFPFSQTAEAFAYLNTNRAIGKVVIHPIP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||