SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g01120

Feature Type:gene_model
Chromosome:Gm19
Start:782414
stop:786356
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g01120
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G23740AT Annotation by Michelle Graham. TAIR10: Oxidoreductase, zinc-binding dehydrogenase family protein | chr1:8398245-8399656 REVERSE LENGTH=386 SoyBaseE_val: 1.00E-131ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010319GO-cc Annotation by Michelle Graham. GO Cellular Compartment: stromule SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0035671GO-mf Annotation by Michelle Graham. GO Molecular Function: enone reductase activity SoyBaseN/AISS
GO:0035798GO-mf Annotation by Michelle Graham. GO Molecular Function: 2-alkenal reductase (NADP+) activity SoyBaseN/AISS
KOG1198 KOG Zinc-binding oxidoreductase JGI ISS
PTHR11695Panther ALCOHOL DEHYDROGENASE RELATED JGI ISS
PTHR11695:SF34Panther gb def: hypothetical protein [pseudomonas stutzeri] JGI ISS
PF00107PFAM Zinc-binding dehydrogenase JGI ISS
PF08240PFAM Alcohol dehydrogenase GroES-like domain JGI ISS
UniRef100_C6TLX4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLX4_SOYBN SoyBaseE_val: 0ISS
UniRef100_D2DWB1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Quinone oxidoreductase-like protein n=1 Tax=Phaseolus vulgaris RepID=D2DWB1_PHAVU SoyBaseE_val: 0ISS

Expression Patterns of Glyma19g01120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g01120
ParalogEvidenceComments
Glyma05g08513 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g01120 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g008300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g01120
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g01120
>Glyma19g01120.1   sequence type=CDS   gene model=Glyma19g01120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAAGATGCTTCAATTATTCCAACACACACAAAAGCTTGGTACTACTCTGAACATGGTAGTCCAGGTGATGTTCTCAAATTAGATCCTAATTGGCCCTTACCCCAACAACTCAAAGATGACCAAGTGCTCATCAAGGTCATCGCTGCATCCATTAATCCCGTTGATTACAAGAGGATGCACGGCGAGTTCAAGGACACTGACCCTCATCTGCCTATTGTGCCGGGTTATGATGTTGCTGGCATAGTAGTGAAAGTGGGAGGAGAAGTAAAAAAATTTAAGGTTGGAGATGAAGTATATGGTGATATCAACGAGCAAGGCTTGTCGAACCTTAAGATTCATGGCACTTTGTCAGAGTATACTATTGCAGAAGAGAGACTATTGGCTCATAAACCATCCAATCTAAGCTTCATTGAAGCTGCTAGCATTCCTTTAGCACTTGAGACTGCTAACGAAGGTTTTGAACATGCTCACTTCTCTGCTGGCAAATCTATCCTTGTTTTGGGAGGAGCTGGTGGAGTTGGAAACTATGTTATTCAGCTAGCTAAACAAGTTTATAAGGCGTCTAAGATAGCAGCAACTGCTAGCACCGGCAAACTTGAACTTTTAAGGGAGTTGGGCGTTGACTTGCCTATTGATTACACAAAGGAGAACTTTGAAGACCTTCCAGAAAAATACGATCTAGTGTATGATGTAGTAGGGCAAGGTGATAGAGCATTTAAGGCCGTTAAGGAAGATGGGAAAGTTGTGACAATAGTACCACCTGGACATCCACCAGCTATGTTTTTCGTGCTCACCTCAAAGGGATCTATCTTAGAGAATTTAAGACCTTACTTTGAGAGTGGTAAGTTGAAGCCTATACTCGATGCCAAGACTCCAGTGCCATTTTCTCAGGTTATTGAAGCCATTTCCTACTTAGAAACTTCAAGAGCCACAGGAAAAGTGGTCGTTTATCCCATACCCTAA
Predicted protein sequences of Glyma19g01120
>Glyma19g01120.1   sequence type=predicted peptide   gene model=Glyma19g01120   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEDASIIPTHTKAWYYSEHGSPGDVLKLDPNWPLPQQLKDDQVLIKVIAASINPVDYKRMHGEFKDTDPHLPIVPGYDVAGIVVKVGGEVKKFKVGDEVYGDINEQGLSNLKIHGTLSEYTIAEERLLAHKPSNLSFIEAASIPLALETANEGFEHAHFSAGKSILVLGGAGGVGNYVIQLAKQVYKASKIAATASTGKLELLRELGVDLPIDYTKENFEDLPEKYDLVYDVVGQGDRAFKAVKEDGKVVTIVPPGHPPAMFFVLTSKGSILENLRPYFESGKLKPILDAKTPVPFSQVIEAISYLETSRATGKVVVYPIP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo