SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g00990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g00990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g00990

Feature Type:gene_model
Chromosome:Gm19
Start:654929
stop:655997
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14700AT Annotation by Michelle Graham. TAIR10: NAD(P)-binding Rossmann-fold superfamily protein | chr5:4740502-4743327 REVERSE LENGTH=368 SoyBaseE_val: 5.00E-79ISS
GO:0009809GO-bp Annotation by Michelle Graham. GO Biological Process: lignin biosynthetic process SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0016621GO-mf Annotation by Michelle Graham. GO Molecular Function: cinnamoyl-CoA reductase activity SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
PTHR10366Panther NAD DEPENDENT EPIMERASE/DEHYDRATASE JGI ISS
PTHR10366:SF9Panther NAD(P)H STEROID DEHYDROGENASE-RELATED JGI ISS
PF01370PFAM NAD dependent epimerase/dehydratase family JGI ISS
UniRef100_G3FJ91UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cinnamoyl-CoA reductase n=1 Tax=Betula platyphylla RepID=G3FJ91_BETPL SoyBaseE_val: 2.00E-99ISS
UniRef100_I1N5P4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N5P4_SOYBN SoyBaseE_val: 1.00E-156ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g00990 not represented in the dataset

Glyma19g00990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g007200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma19g00990.1   sequence type=CDS   gene model=Glyma19g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGAGATTGAAGTAAGGGCTGCTGAGAATGTGATGGAAGCATGTGCAAGAACACCTTCCATAACAAGATGTGTGTTCACATCATCACTATCGGCTTGTGTGTGGCAAGACAATTCACAATCAGATTTTACCCCAGTTATTAATCATGCCTCTTGGAGCACCGAATCATTCTGCATAGAAAAGAAGCTTTGGTATGCTTTAGGAAAGATGAGAGCAGAGAAGGCTGCTTGGAGAATATCTAATGAAAGGGGTTTGAAGCTCACAACTATTTGTCCAGCTCTAATTACAGGTCCTGAATTTTGTCATAGGAATCCAACAGCAACGATTGCTTATCTCAAAGGTGCACAAGAAATGTACTCTCAAGGTTTTCTAGCATCAGTGGATGTGACCAAATTGGCTGAAGCTCATGCAAGTGTATTCAAGGCAATGAACAACGAGGCTTCTGGTAGATACATTTGCTTTGACCATGTAATTGATACACATAGTGAGGCAGAGAAGCTGGCAAAGGATATTGGGATGCCTAAGGAAAAGATATGTGGAGATGCATCAAACAATTCTTCTATACATAGATTTGAATTGTCCAATGAGAAGTTATGCAGAATCATGTCAAGGCCACTCAGGTGTTACAGTGAATATTAG

>Glyma19g00990.1   sequence type=predicted peptide   gene model=Glyma19g00990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEIEVRAAENVMEACARTPSITRCVFTSSLSACVWQDNSQSDFTPVINHASWSTESFCIEKKLWYALGKMRAEKAAWRISNERGLKLTTICPALITGPEFCHRNPTATIAYLKGAQEMYSQGFLASVDVTKLAEAHASVFKAMNNEASGRYICFDHVIDTHSEAEKLAKDIGMPKEKICGDASNNSSIHRFELSNEKLCRIMSRPLRCYSEY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo