SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g00930

Feature Type:gene_model
Chromosome:Gm19
Start:602954
stop:607456
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g00930
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27810AT Annotation by Michelle Graham. TAIR10: myb domain protein 21 | chr3:10307596-10310093 FORWARD LENGTH=226 SoyBaseE_val: 2.00E-86ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009740GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0080086GO-bp Annotation by Michelle Graham. GO Biological Process: stamen filament development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
KOG0048 KOG Transcription factor, Myb superfamily JGI ISS
PTHR10641Panther MYB-RELATED JGI ISS
PF00249PFAM Myb-like DNA-binding domain JGI ISS
UniRef100_Q0PJH1UniRef Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB99 (Fragment) n=1 Tax=Glycine max RepID=Q0PJH1_SOYBN SoyBaseE_val: 5.00E-133ISS
UniRef100_UPI000189D42DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D42D related cluster n=1 Tax=unknown RepID=UPI000189D42D SoyBaseE_val: 3.00E-151ISS

Expression Patterns of Glyma19g00930
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g00930
ParalogEvidenceComments
Glyma05g08690 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g00930 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g006500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g00930
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g00930
>Glyma19g00930.1   sequence type=CDS   gene model=Glyma19g00930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAAAAAACCATGCGACTCATCTCATGATCCAGAAGTGAGAAAGGGACCATGGATCATGGAAGAAGACTTGATCTTGATAAACTATATTGCAAATCACGGTGAAGGTGTTTGGAATTCTTTAGCCAAAGCTTCTGGTCTTAAACGAACGGGAAAGAGTTGTCGACTCCGTTGGCTAAACTACCTTCGTCCTGATGTTAGAAGAGGAAACATTACACCCGAAGAACAGCTTTTGATCATAGAACTTCATGCAAAGTGGGGCAATAGGTGGTCCAAAATTGCAAAGCATCTTCCAGGAAGAACTGACAATGAGATTAAGAACTTCTGGAGAACTAGGATCCAGAAGCACATTAAGCAAGCTGAGACTTCACAACAACATGGTAATTCATCAGAGAATAGTAATAATGATCATCAAGCAAGCAATAGCACTAGCAAGGTGTCCACCATGGCACATCCAAATGAGACTTTCTCTCCACCCTCATACCAAGCAACTTTTGAGCCATTTCAACCTCAATTCCCTACAATCAATGATCAATCAAGTTGTTGTACCAGCAACAACAACTATTGGAGCATCGAGGATATCTGGTCGTCTATGCAATTACTCAATGGAGATTAA
Predicted protein sequences of Glyma19g00930
>Glyma19g00930.1   sequence type=predicted peptide   gene model=Glyma19g00930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKKPCDSSHDPEVRKGPWIMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHIKQAETSQQHGNSSENSNNDHQASNSTSKVSTMAHPNETFSPPSYQATFEPFQPQFPTINDQSSCCTSNNNYWSIEDIWSSMQLLNGD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo