SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g00830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g00830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g00830

Feature Type:gene_model
Chromosome:Gm19
Start:513170
stop:516192
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g00830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G66520AT Annotation by Michelle Graham. TAIR10: formyltransferase, putative | chr1:24816330-24818693 REVERSE LENGTH=355 SoyBaseE_val: 2.00E-48ISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009152GO-bp Annotation by Michelle Graham. GO Biological Process: purine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008864GO-mf Annotation by Michelle Graham. GO Molecular Function: formyltetrahydrofolate deformylase activity SoyBaseN/AISS
GO:0016742GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxymethyl-, formyl- and related transferase activity SoyBaseN/AISS
PTHR11138Panther METHIONYL-TRNA FORMYLTRANSFERASE JGI ISS
PF02911PFAM Formyl transferase, C-terminal domain JGI ISS
UniRef100_B9GV84UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methionyl-trna formyltransferase n=1 Tax=Populus trichocarpa RepID=B9GV84_POPTR SoyBaseE_val: 2.00E-49ISS
UniRef100_UPI000233F1A2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F1A2 related cluster n=1 Tax=unknown RepID=UPI000233F1A2 SoyBaseE_val: 1.00E-70ISS

Expression Patterns of Glyma19g00830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g00830 not represented in the dataset
Glyma19g00830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g00830
ParalogEvidenceComments
Glyma05g09280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g00830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma19g00830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g00830
>Glyma19g00830.1   sequence type=CDS   gene model=Glyma19g00830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTACTATCTTTATTTGACAAAGCAGGATCTAAACTTCTGATTGGGGAACTTCCTTCTATACTTGATGGATCAGCAATAGTAAAGGCTCAACCTCAAGATGACTCTAAGGCTACATTGGCTCCCAAGATAAATCCAGATGAATCATGGCTATCCTTTGATCAAGAAGCATCTGTTCTACACAATAAGGTTCGTGCCTTTTCTGGGTGGCCAGGAACTAGAGCAAGAGTTCATGAGAGTGTGCAGTTCGATGAAGCAGAGAAGATTGCATTTGTTGAGGGTGCGTTGGTGTTTCCATGTGGAAGGGGCACCCCCCCTGGGGATTCGTTTCAAAACTATTTATTTAGACAACAATTTGGGAGAATTAAAAGAAAAAATTGCCTCCCTGTTAGAGATGGAAATTGGAGACAAATGAATAGATTGTTTCATGTATTAGAAGTTCAGCTTCCTGGGAAAAAGGTAGTAAACTCAGCTGCTTTCTGGAATGGACTGCGGGGGCAGAAGCTGAAGAAATTGTGA
Predicted protein sequences of Glyma19g00830
>Glyma19g00830.1   sequence type=predicted peptide   gene model=Glyma19g00830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLSLFDKAGSKLLIGELPSILDGSAIVKAQPQDDSKATLAPKINPDESWLSFDQEASVLHNKVRAFSGWPGTRARVHESVQFDEAEKIAFVEGALVFPCGRGTPPGDSFQNYLFRQQFGRIKRKNCLPVRDGNWRQMNRLFHVLEVQLPGKKVVNSAAFWNGLRGQKLKKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo