SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g00738

Feature Type:gene_model
Chromosome:Gm19
Start:462914
stop:464206
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g00738
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16210AT Annotation by Michelle Graham. TAIR10: HEAT repeat-containing protein | chr5:5290999-5297779 REVERSE LENGTH=1180 SoyBaseE_val: 7.00E-24ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
UniRef100_G7KV74UniRef Annotation by Michelle Graham. Most informative UniRef hit: LisH domain and HEAT repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7KV74_MEDTR SoyBaseE_val: 3.00E-25ISS
UniRef100_I1K1M8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1M8_SOYBN SoyBaseE_val: 3.00E-44ISS

Expression Patterns of Glyma19g00738
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g00738 not represented in the dataset
Glyma19g00738 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g00738
ParalogEvidenceComments
Glyma05g09170 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g00738 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g002000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g00738
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g00738
>Glyma19g00738.1   sequence type=CDS   gene model=Glyma19g00738   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCGCCACGACCAGGCCATTCGCCTCCAAGAGTACTTGTCTGATCCACAAACTCTTCTCCAACTCAAAAACGATTCCGAACACAAGCTGTCCATCACCGATTACCAACTTCGTCTCGCCAAACTCAAATCTCAACTCTACGTTGCTTCTGCTGTGTTCGGGATTACCTCCTGCCAGCTACACAGAACCTGTTAAAAGATTTGGATGCACTGGATCCAGCACACAAAAAGAAGCCATTGAAATTATTATAAAGGAAAGATCTGGGGCAAGTGTTGGTGGTGGTGGTGCAAGCAAGTCGATGGGTTCTCATCTTGGGCTTGTATCATCAGTGAGCAACTTCTTTGGTGATGGTGGCTTGCTTGGAAAGAGAGACAGCACAGAAGCACAGCAGCCAGAGAGAGTTGTATCCCCCAAGGCTACATCACAACCACAACCAGAGGACACTAGATTAAGGCGCATCATGCTGGGACATTTCACCTACATACTTAGGACCAAGGGAAAATCCCAAGACGAAATTCACAACCAATAA
Predicted protein sequences of Glyma19g00738
>Glyma19g00738.1   sequence type=predicted peptide   gene model=Glyma19g00738   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVATTRPFASKSTCLIHKLFSNSKTIPNTSCPSPITNFVSPNSNLNSTLLLLCSGLPPASYTEPVKRFGCTGSSTQKEAIEIIIKERSGASVGGGGASKSMGSHLGLVSSVSNFFGDGGLLGKRDSTEAQQPERVVSPKATSQPQPEDTRLRRIMLGHFTYILRTKGKSQDEIHNQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo