Glyma19g00730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g00730

Feature Type:	gene_model
Chromosome:	Gm19
Start:	461479
stop:	462164
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g00730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75250	AT	Annotation by Michelle Graham. TAIR10: RAD-like 6 \| chr1:28245073-28245453 REVERSE LENGTH=126	SoyBase	E_val: 1.00E-31	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR25040	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25040:SF164	Panther		JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
UniRef100_B9RBF6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RBF6_RICCO	SoyBase	E_val: 2.00E-33	ISS
UniRef100_I1N5L7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N5L7_SOYBN	SoyBase	E_val: 9.00E-40	ISS

Expression Patterns of Glyma19g00730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g00730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g002100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g00730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g00730

Limit To All Plant Sequences

>Glyma19g00730.2   sequence type=CDS   gene model=Glyma19g00730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTCTTCTTCCTCTAGTACTAGTAGATGGACGGTTCAGGAAAACAAAGCGTTTGAAAGAGCTCTAGCAGTTTATGACAAGGACACTCCAAACCGTTGGTGCAACATTGCAAGGGCTGTTGGTGGAAAAACTCCAGAGGAAGTGAGGAGGCACTATGATCGTCTTGTGGAGGACATTAGGCGTATTGAGTCTGGCCAAGTTCCCTTTCCAATTTACAGGAACCTCCAAGATGGGGCATGA

Predicted protein sequences of Glyma19g00730

Limit To All Plant Sequences

>Glyma19g00730.2   sequence type=predicted peptide   gene model=Glyma19g00730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMSSSSSTSRWTVQENKAFERALAVYDKDTPNRWCNIARAVGGKTPEEVRRHYDRLVEDIRRIESGQVPFPIYRNLQDGA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain