Glyma19g00690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g00690

Feature Type:	gene_model
Chromosome:	Gm19
Start:	432056
stop:	432497
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g00690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24974	AT	Annotation by Michelle Graham. TAIR10: Plant self-incompatibility protein S1 family \| chr4:12842889-12843287 FORWARD LENGTH=132	SoyBase	E_val: 3.00E-11	ISS
PF05938	PFAM	Plant self-incompatibility protein S1	JGI		ISS
UniRef100_G7KM98	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Self-incompatibility protein n=1 Tax=Medicago truncatula RepID=G7KM98_MEDTR	SoyBase	E_val: 4.00E-11	ISS
UniRef100_I1N5L3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N5L3_SOYBN	SoyBase	E_val: 5.00E-35	ISS

Expression Patterns of Glyma19g00690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma19g00690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g002500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g00690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g00690

Limit To All Plant Sequences

>Glyma19g00690.2   sequence type=CDS   gene model=Glyma19g00690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGTTTCAATCTCCAAAGTTACGTTAGTACTTTATGTATTGATAATGGTACTTCTTGATGTAACCTTGTACTTTTGTCGCTTTGTATGGTATGGAGCAGTGCGTTATTTTGACATTTATAGACAAGATCGAGATCATTGTTTTGGTAGTCGGTGTTATTGGGAGATATTTGAGATTGGGCCATGTAAGATTAATCCAAGGTCTACTGAATGTTTTATCTGGAATCCATAG

Predicted protein sequences of Glyma19g00690

Limit To All Plant Sequences

>Glyma19g00690.2   sequence type=predicted peptide   gene model=Glyma19g00690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMVSISKVTLVLYVLIMVLLDVTLYFCRFVWYGAVRYFDIYRQDRDHCFGSRCYWEIFEIGPCKINPRSTECFIWNP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain