SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma19g00441

Feature Type:gene_model
Chromosome:Gm19
Start:238429
stop:242106
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma19g00441
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40390AT Annotation by Michelle Graham. TAIR10: Raffinose synthase family protein | chr5:16161720-16165085 FORWARD LENGTH=783 SoyBaseE_val: 9.00E-57ISS
GO:0005986GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose biosynthetic process SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0010325GO-bp Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process SoyBaseN/AISS
GO:0019593GO-bp Annotation by Michelle Graham. GO Biological Process: mannitol biosynthetic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0047274GO-mf Annotation by Michelle Graham. GO Molecular Function: galactinol-sucrose galactosyltransferase activity SoyBaseN/AISS
PF05691PFAM Raffinose synthase or seed inhibition protein Sip1 JGI ISS
UniRef100_B2ZF65UniRef Annotation by Michelle Graham. Best UniRef hit: Raffionse synthase 3 n=3 Tax=Glycine max RepID=B2ZF65_SOYBN SoyBaseE_val: 4.00E-95ISS
UniRef100_B2ZF65UniRef Annotation by Michelle Graham. Most informative UniRef hit: Raffionse synthase 3 n=3 Tax=Glycine max RepID=B2ZF65_SOYBN SoyBaseE_val: 4.00E-95ISS

Expression Patterns of Glyma19g00441
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g00441 not represented in the dataset
Glyma19g00441 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g00441
ParalogEvidenceComments
Glyma05g08950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g00441 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g004400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma19g00441
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma19g00441
>Glyma19g00441.1   sequence type=CDS   gene model=Glyma19g00441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAACGATGAAGAAAATGAGCAATAGAGCTTTTACCAAGTACACTGGAGTTATTGGGGTGTTTAACTGCCAGGGAGGAGGTTGGTTCCGTGAGATTAGGTCCAACAAATGTGCTGCTGAGTTTTCTCACAGGGTATCAACCAAGACATTGAATGGGACAGTGGAAAGAACCCAATTTCCATTGAAGTGGTGCAACTTTTCGCCTTATATCAGCCAAGCTAAGAAACTCATCCTCTCAGCACCATCTGATGACAGTGAAGAGATTTCCTTGGAGCCGTTCAATTTTGAGCTTATAACGGTTTCCTCAGTGACTGCCTTGCGTGGCAAGTCAGTGAAGTTTGCTCCTATTGGTTTGGTGAATATGCTAAACACTGGTGGAGCAGTCCAGTCCTTGGCTTTTGATGAGGCTCAGAATTTGGTTGAAGTTGGTGTAAGAGGCACTGGGGAGATGAGGGTCTATGCCTCAGAGAAACCAACAACTTGTAGAATTGATGGCAAACAAGTTGATTTTGAATATGAAGGGTCCATGGTCAAAATTCAAGTACCATGGCCTGGTTCTTCAAAATTGTCCACTGTCAGTATGTATTATGAGCCAGGGAGAGTGATTTTTTTTTTTTAA
Predicted protein sequences of Glyma19g00441
>Glyma19g00441.1   sequence type=predicted peptide   gene model=Glyma19g00441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLTMKKMSNRAFTKYTGVIGVFNCQGGGWFREIRSNKCAAEFSHRVSTKTLNGTVERTQFPLKWCNFSPYISQAKKLILSAPSDDSEEISLEPFNFELITVSSVTALRGKSVKFAPIGLVNMLNTGGAVQSLAFDEAQNLVEVGVRGTGEMRVYASEKPTTCRIDGKQVDFEYEGSMVKIQVPWPGSSKLSTVSMYYEPGRVIFFF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo