Glyma19g00330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma19g00330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma19g00330): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma19g00330

Feature Type:	gene_model
Chromosome:	Gm19
Start:	136447
stop:	138457
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma19g00330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G40460	AT	Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G27630.1); Has 87 Blast hits to 87 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 87; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr5:16202465-16202803 FORWARD LENGTH=112	SoyBase	E_val: 2.00E-24	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009694	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
UniRef100_I1N5I2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5I2_SOYBN	SoyBase	E_val: 1.00E-70	ISS

Expression Patterns of Glyma19g00330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma19g00330 not represented in the dataset	Glyma19g00330 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma19g00330

Paralog	Evidence	Comments
Glyma05g08820	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma19g00330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.19g005400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma19g00330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma19g00330

Limit To All Plant Sequences

>Glyma19g00330.1   sequence type=CDS   gene model=Glyma19g00330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTTCTCGCATTCGGACTTGGAATCGGAATCCAAGAAGTGGGTAATTGCCGGAATCGGTGTTTGCTCGCTCAAACCCATCAAAACAAAGCGCGTTGCTGGCGGCGGTGACAACGAAGAAGAAGAAGAAGAAGAAACGCGTTCCACGACGCCGACGGCGAAAGAGGCGAGAATACCGGAAAAGTTGCCGTGCCCGCCGGCGCCGAGGAAACGCCGACCACCGTCAAGGTGTGGTAGCAACGGTGGCGGTGGTGGTGTGAGAGAGTTCTTCACACCACCTGATTTGGAAAGTGTCTTCAAGTGCCATGTTGAGAAAGCCAAATGA

Predicted protein sequences of Glyma19g00330

Limit To All Plant Sequences

>Glyma19g00330.1   sequence type=predicted peptide   gene model=Glyma19g00330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFSHSDLESESKKWVIAGIGVCSLKPIKTKRVAGGGDNEEEEEEETRSTTPTAKEARIPEKLPCPPAPRKRRPPSRCGSNGGGGGVREFFTPPDLESVFKCHVEKAK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain