SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g53990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g53990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g53990

Feature Type:gene_model
Chromosome:Gm18
Start:62243566
stop:62246552
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13190AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: LPS-induced tumor necrosis factor alpha factor (InterPro:IPR006629); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:4204987-4206205 REVERSE LENGTH=134 SoyBaseE_val: 1.00E-64ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0034051GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR23292Panther LIPOPOLYSACCHARIDE-INDUCED TRANSCRIPTION FACTOR REGULATING TUMOR NECROSIS FACTOR ALPHA JGI ISS
PF10601PFAM LITAF-like zinc ribbon domain JGI ISS
UniRef100_C6SVS5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVS5_SOYBN SoyBaseE_val: 1.00E-98ISS
UniRef100_Q4U6G1UniRef Annotation by Michelle Graham. Most informative UniRef hit: LITAF-domain-containing protein n=1 Tax=Pisum sativum RepID=Q4U6G1_PEA SoyBaseE_val: 9.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g53990 not represented in the dataset

Glyma18g53990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g47500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g301900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g53990.1   sequence type=CDS   gene model=Glyma18g53990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAAACAGAGGAAAAGGTGGCGGTGGGCGTGCCAGTGCAATTGTATTACGGTGGAGAAAATGAATATCAAAGGGGAATGATCCCTCCTAACACGGTGTTTGGAGATCCAAAGGGCATCCCCATCCAGCAGACCATTTACAGGGACACTCCTGCTCCTTTCAACTGCCCTTACTGCGGTGACACCGCTCTCACTACCGTCAGATCAAAGCCCAGTCTAGCAGCATTTGTTGGATGCTTTGTGCCGATGATGCTTGGAGTTTGCTTTCTTTGCCCTTCAATGGATTGCCTTTGGCATAAATATCACTACTGTCCTAAATGTCAAGAAAAGGTTGCTGACTTTGAGAAATCAGATCCCTGTGCTGTGATGGATCCACCACACTGGACTCAGGAGAGCTTTGCATTGTCTGGATAG

>Glyma18g53990.1   sequence type=predicted peptide   gene model=Glyma18g53990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKTEEKVAVGVPVQLYYGGENEYQRGMIPPNTVFGDPKGIPIQQTIYRDTPAPFNCPYCGDTALTTVRSKPSLAAFVGCFVPMMLGVCFLCPSMDCLWHKYHYCPKCQEKVADFEKSDPCAVMDPPHWTQESFALSG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo