Glyma18g53970 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g53970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g53970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g53970

Feature Type:	gene_model
Chromosome:	Gm18
Start:	62235853
stop:	62237479
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g53970

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G21090	AT	Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein \| chr5:7164758-7166904 FORWARD LENGTH=218	SoyBase	E_val: 4.00E-90	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0006972	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic response	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF836	Panther		JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
PF08263	PFAM	Leucine rich repeat N-terminal domain	JGI		ISS
UniRef100_C6TAZ1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TAZ1_SOYBN	SoyBase	E_val: 1.00E-155	ISS
UniRef100_G7KWK3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Somatic embryogenesis receptor kinase n=1 Tax=Medicago truncatula RepID=G7KWK3_MEDTR	SoyBase	E_val: 6.00E-127	ISS

Expression Patterns of Glyma18g53970

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g53970 not represented in the dataset	Glyma18g53970 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g53970 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g301700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g53970

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g53970

Limit To All Plant Sequences

>Glyma18g53970.1   sequence type=CDS   gene model=Glyma18g53970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACGAGCCAGCTTTTTAATGTTCTTGCCATTTTTCTTCTCTCGGACCCTTTTGCTGTTGTGAATGCAAACTCTGAAGGTGATGCTCTGTTCGCGTTCAGAAGAGCTGTGAAAGACCCAAATAACGTTCTAGAGAGCTGGGATCCAACTTTGGTGGATCCTTGTACATGGTTCCATATTACCTGTGATGATGATAAGCGAGTTACCCGACTAGACCTCGGACACGCAAAACTGTCTGGCCATTTGGTTCCAGAGCTAGGGAGGCTCCAGCGCCTTCAGTTCCTAGAACTGTACAAGAATGATTTGATGGGTCCAATACCAAAGGAACTTGGAGAACTCAAGAACCTGCTTAGCTTGGGTCTCTACCAGAATAACCTCACTGGCTCCATCCCCGCCACCCTCTCCAACCTCTCCAACATCAAATTCTTGCGACTCAACAGCAACAAGCTCACTGGAAGAATACCGAGGGAACTCACTAAGTTGGGAAACCTCAAGATCTTAGACCTATCAAACAATGATCTATGTGGTACTTTCCCGACATACGGCTCCTTTTCCAAGTTCTCCCAAGAAAGTTTCAAGAATAACCCAAGACTTAAAGGACCAGAATTAATGGGATTCGTCAGATATGATACTGGAGAAAGCTGCAAATGA

Predicted protein sequences of Glyma18g53970

Limit To All Plant Sequences

>Glyma18g53970.1   sequence type=predicted peptide   gene model=Glyma18g53970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METSQLFNVLAIFLLSDPFAVVNANSEGDALFAFRRAVKDPNNVLESWDPTLVDPCTWFHITCDDDKRVTRLDLGHAKLSGHLVPELGRLQRLQFLELYKNDLMGPIPKELGELKNLLSLGLYQNNLTGSIPATLSNLSNIKFLRLNSNKLTGRIPRELTKLGNLKILDLSNNDLCGTFPTYGSFSKFSQESFKNNPRLKGPELMGFVRYDTGESCK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain