Glyma18g53940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53940

Feature Type:	gene_model
Chromosome:	Gm18
Start:	62193884
stop:	62196748
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g53940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13170	AT	Annotation by Michelle Graham. TAIR10: senescence-associated gene 29 \| chr5:4181331-4183171 REVERSE LENGTH=292	SoyBase	E_val: 3.00E-120	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0015770	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose transport	SoyBase	N/A	ISS
GO:0071215	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0071446	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to salicylic acid stimulus	SoyBase	N/A	ISS
GO:0071470	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to osmotic stress	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0008515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sucrose transmembrane transporter activity	SoyBase	N/A	ISS
GO:0051119	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sugar transmembrane transporter activity	SoyBase	N/A	ISS
KOG1623	KOG	Multitransmembrane protein	JGI		ISS
PTHR10791	Panther	STROMAL CELL PROTEIN/NODULIN MTN3-RELATED	JGI		ISS
PF03083	PFAM	MtN3/saliva family	JGI		ISS
UniRef100_G7KWM1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein RUPTURED POLLEN GRAIN n=2 Tax=Medicago truncatula RepID=G7KWM1_MEDTR	SoyBase	E_val: 3.00E-131	ISS
UniRef100_UPI000233E11F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E11F related cluster n=1 Tax=unknown RepID=UPI000233E11F	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma18g53940

Locus	Gene Symbol	Protein Name
	SWEET46	sucrose transporter gene 46
	SWEET46	sucrose effluxer gene 46

Expression Patterns of Glyma18g53940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g53940

Paralog	Evidence	Comments
Glyma08g47550	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g53940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g301200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g53940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g53940

Limit To All Plant Sequences

>Glyma18g53940.1   sequence type=CDS   gene model=Glyma18g53940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATCAGTCACCATACTTTGGCATTTACATTTGGCATGCTAGGTAATTTGATTTCATTCTTGGTATTCTTGGCTCCAGTGCCAACATTTTACCGGATATACAAGAAGAAATCGACGGAAAGTTTTCAGTCACTGCCTTATTTGGTGGCATTATTCAGTTCAATGCTTTGGTTGTACTATGCGATGCTCAAAAGAGATGCTGTTCTTCTCATTACCATTAACTCATTCGGATGTGTTATAGAGATCATCTACATCGTCTTGTACATCACCTATGCAACCAGGGATGCTAGGAACTTAACTATTAAGCTATTTTCGGCGATGAACATGAGTTCCTTTGCTTTGATACTCTTAGTCACACACTTTGCGGTGCATGGTCCCCTTCGTGTCCAAGTCCTCGGATGGATTTGCGTTTCGATTTCAGTTAGTGTCTTTGCAGCTCCACTAAGCATTGTGGCACAAGTAGTTCGCACAAAGAGTGTAGAGTTTATGCCTTTCAATTTGTCATTCACCCTCACATTGAGTGCCATAATGTGGTTTGGTTATGGCCTCTTTCTCAAGGACATATGCATTGCTCTCCCAAACGTGCTTGGTTTTGTGCTGGGGTTACTTCAAATGCTGCTCTACACAATTTACAGAAAAGGAAATAAGAAGACAAAAACAAACGAAAAGAGTCCAGTAGAGCCACTGAAAAGCATTGCTGTAGTGAACCCGTTGGGAACTGGAGAAGTGTTTCCTGTGGAGGAAGATGAACAAGCTGCAAAAAAGAGCCAAGGAGATGGAGATGATAAAAAGGGCCAAGACTGCCTAGTCTAA

Predicted protein sequences of Glyma18g53940

Limit To All Plant Sequences

>Glyma18g53940.1   sequence type=predicted peptide   gene model=Glyma18g53940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVISHHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAMLKRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTHFAVHGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGLFLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSPVEPLKSIAVVNPLGTGEVFPVEEDEQAAKKSQGDGDDKKGQDCLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain