Glyma18g53795 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53795

Feature Type:	gene_model
Chromosome:	Gm18
Start:	62061371
stop:	62063640
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g53795

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27435	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 16 Blast hits to 16 proteins in 8 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 16; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr1:9527956-9528814 REVERSE LENGTH=81	SoyBase	E_val: 1.00E-27	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_UPI000233F41F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F41F related cluster n=1 Tax=unknown RepID=UPI000233F41F	SoyBase	E_val: 3.00E-43	ISS

Expression Patterns of Glyma18g53795

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g53795 not represented in the dataset	Glyma18g53795 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g53795

Paralog	Evidence	Comments
Glyma08g47690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g53795 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g300000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g53795

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g53795

Limit To All Plant Sequences

>Glyma18g53795.1   sequence type=CDS   gene model=Glyma18g53795   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATTTTGGGGGACGCGGGTGATGGAGATTGTGAAGAAGCATGATTCTGGAGGGCTGGTTTGGAAGAGAATCAAGCTCACCACCACCCGAAAAGCCAATGCTAAGAAGCGTCTTCTTCGGGTTTGGCAGAATGAAGCTGTCCTCAAAGCCTGTTCTGCCACTCCCAACGAACCTCAACCTACACCAGTGGCTACACCAGTGGCTAGTTAA

Predicted protein sequences of Glyma18g53795

Limit To All Plant Sequences

>Glyma18g53795.1   sequence type=predicted peptide   gene model=Glyma18g53795   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFWGTRVMEIVKKHDSGGLVWKRIKLTTTRKANAKKRLLRVWQNEAVLKACSATPNEPQPTPVATPVAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain