SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53690

Feature Type:gene_model
Chromosome:Gm18
Start:61960785
stop:61963332
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g53690
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20370AT Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein | chr4:11001011-11002965 REVERSE LENGTH=175 SoyBaseE_val: 9.00E-86ISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008429GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding SoyBaseN/AISS
KOG3346 KOG Phosphatidylethanolamine binding protein JGI ISS
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI ISS
PF01161PFAM Phosphatidylethanolamine-binding protein JGI ISS
UniRef100_E3WC96UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flowering locus T n=2 Tax=Glycine max RepID=E3WC96_SOYBN SoyBaseE_val: 6.00E-125ISS
UniRef100_E3WC96UniRef Annotation by Michelle Graham. Best UniRef hit: Flowering locus T n=2 Tax=Glycine max RepID=E3WC96_SOYBN SoyBaseE_val: 6.00E-125ISS

Proteins Associated with Glyma18g53690
LocusGene SymbolProtein Name
FT1b Flowering locus T gene 1b
FT1b Flowering Locus T 1 gene b
FT1b Flowering Locus T 1 gene b

Expression Patterns of Glyma18g53690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g53690 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g299000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g53690
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g53690
>Glyma18g53690.1   sequence type=CDS   gene model=Glyma18g53690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACCCTCTTGTCATTGGACGTGTAGTAGGAGATGTTTTGGAGCCTTTCACTAGTTGCGTCTCTCTTAGGATTCTATATGACAGCTGCTCCGAAGTTATCAACTGCTGTGAGCTCAAACCCTTCCAAATCATCAACCAACCTAGAGTTGAAGTTGGTGGTGATGACTTCAGGACCTTTTACACCCTGGTAATGGTGGATCCTGATGCACCTAGCCCAGGAAATCCAAATCAGAGGGAATATTTGCACTGGTTGGTAACCAATATTCCAGGAACTACAGGAGCAAACTTCGGTGAAGAGGTTGTGAGCTATGAGAGTCCACGACCGATGATGGGAATTCATCGTATTATTTTCATATTATTTCGTCAGTCAGGTAGACAAACTATATATGCTCCAGGATGGCGTCAAAATTTCAACACGAGAGATTTCAGCGAGGTTTATAATCTTGGATTACCAGTGGCAGCAACCTACTTCAACTGTAAACGTCAAAATAATTCCGCAAGAGATGGAAGAAGGACATGA
Predicted protein sequences of Glyma18g53690
>Glyma18g53690.1   sequence type=predicted peptide   gene model=Glyma18g53690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPLVIGRVVGDVLEPFTSCVSLRILYDSCSEVINCCELKPFQIINQPRVEVGGDDFRTFYTLVMVDPDAPSPGNPNQREYLHWLVTNIPGTTGANFGEEVVSYESPRPMMGIHRIIFILFRQSGRQTIYAPGWRQNFNTRDFSEVYNLGLPVAATYFNCKRQNNSARDGRRT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo