Report for Sequence Feature Glyma18g53460
Feature Type: gene_model
Chromosome: Gm18
Start: 61777723
stop: 61778923
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g53460
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G19040 AT
Annotation by Michelle Graham. TAIR10: isopentenyltransferase 5 | chr5:6362389-6363381 REVERSE LENGTH=330
SoyBase E_val: 3.00E-89 ISS
GO:0007131 GO-bp
Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination
SoyBase N/A ISS
GO:0008033 GO-bp
Annotation by Michelle Graham. GO Biological Process: tRNA processing
SoyBase N/A ISS
GO:0009691 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinin biosynthetic process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009536 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plastid
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0009824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: AMP dimethylallyltransferase activity
SoyBase N/A ISS
GO:0016765 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups
SoyBase N/A ISS
GO:0052622 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP dimethylallyltransferase activity
SoyBase N/A ISS
GO:0052623 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ADP dimethylallyltransferase activity
SoyBase N/A ISS
KOG1384
KOG
tRNA delta(2)-isopentenylpyrophosphate transferase
JGI ISS
PTHR11088 Panther
TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE TRANSFERASE-RELATED
JGI ISS
PTHR11088:SF20 Panther
CYTOKININ SYNTHASE
JGI ISS
PF01715 PFAM
IPP transferase
JGI ISS
UniRef100_G7IZ05 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Adenylate isopentenyltransferase n=1 Tax=Medicago truncatula RepID=G7IZ05_MEDTR
SoyBase E_val: 5.00E-143 ISS
UniRef100_I1N5C5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1N5C5_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma18g53460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g53460
Paralog Evidence Comments
Glyma08g48020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g53460 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g297300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g53460
Coding sequences of Glyma18g53460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g53460.2 sequence type=CDS gene model=Glyma18g53460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCATTTGTTCAAACAAACTATTTTGGTGTTTTTTCTTATCAACTTTCTCCAAATATATATTATATTAAATACTCTCATGGCGCCTTTGTCACTCGCCGAAAAAAAGAAGGTTCTTTTCATAATGGGTGCAACGGGCACAGGCAAAACAAAGTTATCCATCAACTTGGGCACTCAATTCCCTTCTGAAGTCATTAACTCTGACAAAATCCAAGTCTATAAGGGCTTGGACATCATCACAAACAAGGTACCAGAGTCTGAACGTAATGGCATTCCTCATCATCTGCTAGGCATCATCGATGATCCTGATTATGACTTCACAGTTGATGACTTTTGCAAGCATGTCCTCATTGCTCTTGATCTTATTATTGAAAATGGACACCTACCCATTATCGTGGGAGGCTCAAACACTTACCTTGCAACATTGCTTGAGGATCCCAACATCGCATTTCGTTCCAAATATGATTGTTGCTTCATTTGGGTTGATGTGTCTTTACCTGTGTTGTTTCAGTATTTAGATAAAAGGGTGGACGAAATGCTTGATAAAGGAGTTGTTGATGAGATTCGAGAAACTTTTGTGCCTGGAGCAGACTACTCTCGTGGGGTTAGAAGAGCCATCGGGGTTCCTGAGCTGGGGGAGTATTTCTTGGTTGAGAAGAAAATAGATGATGAGACCAAAAAGGAGAAGATGTTGCAAGGTGCTATTGCGAGAACTAAAGAGAACACTTGTAAATTGGCTGAGGCGCAACTCTTGAAGATACATAAGATGAACTATGAGTTTGGATGGGGAATGACCAAAATTGATTCCACACAAGTGTTTGAGGCAGTTTTAAAAGGAATGGATTATAAGCACTTATACCATGAGATTGTGTTCAAACCAAGCGTGGATATAGTGAAAAGATTTCTACATGAGACAACTTCAGGAAAGGGAAAGGCACTGCGTCAAAATGGTGAACAAGTGACGGTTGTGCTTCAAAAATCGTTGAAATTGGCTAAGGATTAG
Predicted protein sequences of Glyma18g53460
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g53460.2 sequence type=predicted peptide gene model=Glyma18g53460 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHLFKQTILVFFLINFLQIYIILNTLMAPLSLAEKKKVLFIMGATGTGKTKLSINLGTQFPSEVINSDKIQVYKGLDIITNKVPESERNGIPHHLLGIIDDPDYDFTVDDFCKHVLIALDLIIENGHLPIIVGGSNTYLATLLEDPNIAFRSKYDCCFIWVDVSLPVLFQYLDKRVDEMLDKGVVDEIRETFVPGADYSRGVRRAIGVPELGEYFLVEKKIDDETKKEKMLQGAIARTKENTCKLAEAQLLKIHKMNYEFGWGMTKIDSTQVFEAVLKGMDYKHLYHEIVFKPSVDIVKRFLHETTSGKGKALRQNGEQVTVVLQKSLKLAKD*