Glyma18g53440 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53440

Feature Type:	gene_model
Chromosome:	Gm18
Start:	61720443
stop:	61721988
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g53440

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G02550	AT	Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 41 \| chr3:536747-537650 REVERSE LENGTH=263	SoyBase	E_val: 4.00E-106	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PF03195	PFAM	Protein of unknown function DUF260	JGI		ISS
UniRef100_G7KMR0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein n=1 Tax=Medicago truncatula RepID=G7KMR0_MEDTR	SoyBase	E_val: 2.00E-105	ISS
UniRef100_UPI000233F2AB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F2AB related cluster n=1 Tax=unknown RepID=UPI000233F2AB	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g53440

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g53440

Paralog	Evidence	Comments
Glyma08g48040	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g53440 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g297100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g53440

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g53440

Limit To All Plant Sequences

>Glyma18g53440.1   sequence type=CDS   gene model=Glyma18g53440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGGATGAGCTGCAATGGATGTCGAGTTCTCAGAAAAGGTTGCAGTGAAAATTGCAGCATCAGACCCTGTTTACAATGGATCAAAAGCCCAGAATCTCAAGCCAATGCTACTGTGTTTCTTGCCAAGTTCTACGGCCGTGCTGGTCTAATGAACCTGGTTAACGCAGGCCCCGAACATCTTCGTCCAGCGATCTTTCGTTCGTTGTTGTACGAGGCATGCGGTCGGATATTGAACCCGATTTACGGGTCTGTCGGGTTGTTATGGTCCGGGAGCTGGCAGCTATGTCAAGCCGCCGTGGAAAACGTCTTGAAAGGCGCACCGATTACGCCGATCACGTCCGAAGCCGCGGCTAGCGGGCGGGGCCCACCGCTCAAGGCTTACGACATACGCCACGTGTCCAAAGACGAGAACTCCGCCGCCGCGTCCAACGAAACTCAGCACCAACGAGTCAAGACTCGGTCTCGAGTGAAGCGACCCCTCGCCAACAACAACGCCAAGCCCAAATCCACCACCAACGAAAACAACAACAATAAGGGAACCGAATTGGGTTCAGCTGAACCGAGTTTGGTGGCATGCGAGTGGACCGAAGAGGTGATGAACCGGTCTGGAAGTCACGATTCGACGCTGAGCCACCAGTCGGAGGCGGCGAATGCGGTGGAGAGCGAGAGCATGCTGTCGGCGGAGACGCCGGAGACTTCGATTCTCTTCCGAGAAGAACCGGAAACGAACCCGAAGCGTGTGAGCGATGATGTTGGTTTAGAGCTTACGCTTGGGTTCGAACCGGTTTCACGTGCGCGGCCCGTGGTTCCGGTGAAGAAAAGAAGGATTGAGTTGAAAAATTTTAGTGGCTCGGCTGAGAGTGGCTCGTGCAAGATGGAGCTGGGGCTTGAATGTTCGGCTTGA

Predicted protein sequences of Glyma18g53440

Limit To All Plant Sequences

>Glyma18g53440.1   sequence type=predicted peptide   gene model=Glyma18g53440   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRMSCNGCRVLRKGCSENCSIRPCLQWIKSPESQANATVFLAKFYGRAGLMNLVNAGPEHLRPAIFRSLLYEACGRILNPIYGSVGLLWSGSWQLCQAAVENVLKGAPITPITSEAAASGRGPPLKAYDIRHVSKDENSAAASNETQHQRVKTRSRVKRPLANNNAKPKSTTNENNNNKGTELGSAEPSLVACEWTEEVMNRSGSHDSTLSHQSEAANAVESESMLSAETPETSILFREEPETNPKRVSDDVGLELTLGFEPVSRARPVVPVKKRRIELKNFSGSAESGSCKMELGLECSA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain