SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53390

Feature Type:gene_model
Chromosome:Gm18
Start:61681961
stop:61683419
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g53390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47820AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G47813.1); Has 29 Blast hits to 29 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 29; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:17612114-17612404 FORWARD LENGTH=96 SoyBaseE_val: 5.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7ZY12UniRef Annotation by Michelle Graham. Most informative UniRef hit: F-box protein n=1 Tax=Medicago truncatula RepID=G7ZY12_MEDTR SoyBaseE_val: 4.00E-19ISS
UniRef100_I1N5B7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N5B7_SOYBN SoyBaseE_val: 6.00E-57ISS

Expression Patterns of Glyma18g53390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g53390
ParalogEvidenceComments
Glyma08g48101 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g53390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g296500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g53390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g53390
>Glyma18g53390.1   sequence type=CDS   gene model=Glyma18g53390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCACAATCTTGTGATGCTAGGCCACATTTGAAGGCCACATTTCGTCTTGGCTCAGAATCATATTCTGTTCAGGCAAACAAAGGTTCCTTATCAGAACAATTGGTTTCACTGAAAGAGGAGAGCATGACCATATTGAAGGATTTCATAACAAAGCATAATGTTCCTCATGATGTCCCAGACGAGCCATTAGAAGCTTCTTCAGATGATGATGATATTCCCGAGAAGCCTCAAGGGAAGTCTAAGAAAACCAAGTTGACTTAG
Predicted protein sequences of Glyma18g53390
>Glyma18g53390.1   sequence type=predicted peptide   gene model=Glyma18g53390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAQSCDARPHLKATFRLGSESYSVQANKGSLSEQLVSLKEESMTILKDFITKHNVPHDVPDEPLEASSDDDDIPEKPQGKSKKTKLT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo