Glyma18g53270 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g53270

Feature Type:	gene_model
Chromosome:	Gm18
Start:	61564808
stop:	61565690
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g53270

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G16150	AT	Annotation by Michelle Graham. TAIR10: plastidic GLC translocator \| chr5:5272904-5275678 FORWARD LENGTH=546	SoyBase	E_val: 1.00E-60	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0010353	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to trehalose stimulus	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005351	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity	SoyBase	N/A	ISS
GO:0015144	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0022857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity	SoyBase	N/A	ISS
PTHR24063	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24063:SF84	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00083	PFAM	Sugar (and other) transporter	JGI		ISS
UniRef100_G7KUB8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hexose transporter n=1 Tax=Medicago truncatula RepID=G7KUB8_MEDTR	SoyBase	E_val: 2.00E-68	ISS
UniRef100_UPI000233F2A5	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F2A5 related cluster n=1 Tax=unknown RepID=UPI000233F2A5	SoyBase	E_val: 5.00E-76	ISS

Expression Patterns of Glyma18g53270

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g53270

Paralog	Evidence	Comments
Glyma08g48255	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g53270 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g53270

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g53270

Limit To All Plant Sequences

>Glyma18g53270.1   sequence type=CDS   gene model=Glyma18g53270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCTTCTTTTTGTGTCTTTTACTTGGAAGGTCCTTGCTCCATATTCTGGCACCCTTGCAGTCCTTGGGACTGTCCTCTATGTCTTATCTTTCTCTCTTGGTGCTGGTCCTGTGCCTGCCCTTCTTCTACCAGAGATATTTGCGTCTAGAATCAGAGCAAAAGCAATTTCTCTGTCATTAGGCACACATTGGATCTCCAACTTTGTCATCGGGCTCTATTTCTTGAGTGTGGTAAACAAGTTTGGTATCAGCATAGTGTACTTGGGCTTCTCAATTGTCTGTCTTCTCACTGTCTTGTACATAGCTCGTAACGTTGTGGAAACAAAAGGTCGATCCTTGGAAGAAATAGAACGTGCACTTAGTCCTGCAACATAA

Predicted protein sequences of Glyma18g53270

Limit To All Plant Sequences

>Glyma18g53270.1   sequence type=predicted peptide   gene model=Glyma18g53270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLLFVSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAISLSLGTHWISNFVIGLYFLSVVNKFGISIVYLGFSIVCLLTVLYIARNVVETKGRSLEEIERALSPAT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain