SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g53270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g53270): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g53270

Feature Type:gene_model
Chromosome:Gm18
Start:61564808
stop:61565690
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16150AT Annotation by Michelle Graham. TAIR10: plastidic GLC translocator | chr5:5272904-5275678 FORWARD LENGTH=546 SoyBaseE_val: 1.00E-60ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0010353GO-bp Annotation by Michelle Graham. GO Biological Process: response to trehalose stimulus SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005351GO-mf Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity SoyBaseN/AISS
GO:0015144GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity SoyBaseN/AISS
GO:0022857GO-mf Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity SoyBaseN/AISS
PTHR24063Panther FAMILY NOT NAMED JGI ISS
PTHR24063:SF84Panther SUBFAMILY NOT NAMED JGI ISS
PF00083PFAM Sugar (and other) transporter JGI ISS
UniRef100_G7KUB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hexose transporter n=1 Tax=Medicago truncatula RepID=G7KUB8_MEDTR SoyBaseE_val: 2.00E-68ISS
UniRef100_UPI000233F2A5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F2A5 related cluster n=1 Tax=unknown RepID=UPI000233F2A5 SoyBaseE_val: 5.00E-76ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g53270 not represented in the dataset

Glyma18g53270 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g48255 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g53270.1   sequence type=CDS   gene model=Glyma18g53270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCTTCTTTTTGTGTCTTTTACTTGGAAGGTCCTTGCTCCATATTCTGGCACCCTTGCAGTCCTTGGGACTGTCCTCTATGTCTTATCTTTCTCTCTTGGTGCTGGTCCTGTGCCTGCCCTTCTTCTACCAGAGATATTTGCGTCTAGAATCAGAGCAAAAGCAATTTCTCTGTCATTAGGCACACATTGGATCTCCAACTTTGTCATCGGGCTCTATTTCTTGAGTGTGGTAAACAAGTTTGGTATCAGCATAGTGTACTTGGGCTTCTCAATTGTCTGTCTTCTCACTGTCTTGTACATAGCTCGTAACGTTGTGGAAACAAAAGGTCGATCCTTGGAAGAAATAGAACGTGCACTTAGTCCTGCAACATAA

>Glyma18g53270.1   sequence type=predicted peptide   gene model=Glyma18g53270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLLFVSFTWKVLAPYSGTLAVLGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAISLSLGTHWISNFVIGLYFLSVVNKFGISIVYLGFSIVCLLTVLYIARNVVETKGRSLEEIERALSPAT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo