Report for Sequence Feature Glyma18g52920
Feature Type: gene_model
Chromosome: Gm18
Start: 61357289
stop: 61357923
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g52920
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G01300 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G15010.1); Has 73 Blast hits to 73 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 73; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:151221-151691 REVERSE LENGTH=156
SoyBase E_val: 2.00E-21 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1N581 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N581_SOYBN
SoyBase E_val: 6.00E-105 ISS
Expression Patterns of Glyma18g52920
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g52920 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g292100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g52920
Coding sequences of Glyma18g52920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g52920.1 sequence type=CDS gene model=Glyma18g52920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGCTACAAATCTGGGATGCTGCAAGCTTTCATGGGGGTCAGTGATTTCCAAGAACGTTAACCTAACAAGCCAGAAGCGTATGGTTAGAAGGAGGTGCGAAAGTGGGGATGGTTGGGGGAGATTGGTTGATGAGGGCATGATAGTGCTGCGTTGGCGTATAAAGGAGATGAAGAGGATGGAGGAGGCGAATCAAGAGGTTCCTTCTCATTGGATGGAGTGGGAGAAGCAGTACTATGCTCATTATTATGACCAACATGTTTTTCATGCCATGGAGTTATTGCAGTCTTATTTGATGAGCCTCAGGCTCAGACCCATTGTAGCATTAGGGGTGTTAGTCCTTGTATCTTTGAGTGTGCTCATGTGTTCCGGGGTGGGCTTCTTTCATGCCCTAGAGGTAGCAAATAGCCTCGTATCTTACTTTTACTCATCAAGGGAATTAATATAA
Predicted protein sequences of Glyma18g52920
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g52920.1 sequence type=predicted peptide gene model=Glyma18g52920 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEATNLGCCKLSWGSVISKNVNLTSQKRMVRRRCESGDGWGRLVDEGMIVLRWRIKEMKRMEEANQEVPSHWMEWEKQYYAHYYDQHVFHAMELLQSYLMSLRLRPIVALGVLVLVSLSVLMCSGVGFFHALEVANSLVSYFYSSRELI*