SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g52700

Feature Type:gene_model
Chromosome:Gm18
Start:61232904
stop:61234343
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g52700
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G39518AT Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0497) | chr2:16496029-16496937 REVERSE LENGTH=174 SoyBaseE_val: 4.00E-28ISS
PF04535PFAM Domain of unknown function (DUF588) JGI ISS
UniRef100_C6T1Z6UniRef Annotation by Michelle Graham. Most informative UniRef hit: CASP-like protein 12 n=1 Tax=Glycine max RepID=CSPLC_SOYBN SoyBaseE_val: 4.00E-82ISS
UniRef100_C6T4S9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T4S9_SOYBN SoyBaseE_val: 3.00E-110ISS

Expression Patterns of Glyma18g52700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g52700 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g290100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g52700
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g52700
>Glyma18g52700.1   sequence type=CDS   gene model=Glyma18g52700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAATACCCCGCCCTCCAGTTCCACAGTTTCAAGAACTGTCCTTCTCCTTTTGAGGGTCTTAATCTTTGTCTTCCTTCTCATTGCTCTCATTCTCATTGCCATAGTCAAGCAAACTGATGATGAAACAGGTGCCGAAATCAAGTTCAATGATATCTATGCTTATCGATATATGATATCTACAATAATAATCGGGTTTGCGTATAATCTGCTGCAAATGGCTTTCTCAATGTTCACTGTGGTCTCAGGAAACCGTGTATTAAGCGGTGATGGTGGCTATCTATTTGATTTCTTCGGTGACAAGATCATATCATACCTTTTGATTTCCGGTTCAGCTGCTGGATTTGGTGTGACCGTAGAGCTTGGTAGAGGTGTACCCTCAAACTCCTTCATTGAGAAGGCAAATGCTTCAGCCAGCCTTCTACTAATTGGATTTTTACTCACTGCCATAGCATCAACTTTCACTTCCTTTGCTTTGCCAAAGAAAGCTAATTAA
Predicted protein sequences of Glyma18g52700
>Glyma18g52700.1   sequence type=predicted peptide   gene model=Glyma18g52700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVNTPPSSSTVSRTVLLLLRVLIFVFLLIALILIAIVKQTDDETGAEIKFNDIYAYRYMISTIIIGFAYNLLQMAFSMFTVVSGNRVLSGDGGYLFDFFGDKIISYLLISGSAAGFGVTVELGRGVPSNSFIEKANASASLLLIGFLLTAIASTFTSFALPKKAN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo