SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g52510

Feature Type:gene_model
Chromosome:Gm18
Start:61093388
stop:61094254
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g52510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57450AT Annotation by Michelle Graham. TAIR10: homolog of X-ray repair cross complementing 3 (XRCC3) | chr5:23274008-23274922 REVERSE LENGTH=304 SoyBaseE_val: 4.00E-99ISS
GO:0000724GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via homologous recombination SoyBaseN/AISS
GO:0006281GO-bp Annotation by Michelle Graham. GO Biological Process: DNA repair SoyBaseN/AISS
GO:0006302GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair SoyBaseN/AISS
GO:0006312GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic recombination SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0010212GO-bp Annotation by Michelle Graham. GO Biological Process: response to ionizing radiation SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043687GO-bp Annotation by Michelle Graham. GO Biological Process: post-translational protein modification SoyBaseN/AISS
GO:0045003GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair via synthesis-dependent strand annealing SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003684GO-mf Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding SoyBaseN/AISS
GO:0003697GO-mf Annotation by Michelle Graham. GO Molecular Function: single-stranded DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008094GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity SoyBaseN/AISS
KOG1564 KOG DNA repair protein RHP57 JGI ISS
PTHR22942Panther RECA/RAD51/RADA DNA STRAND-PAIRING FAMILY MEMBER JGI ISS
PTHR22942:SF24Panther SUBFAMILY NOT NAMED JGI ISS
PF08423PFAM Rad51 JGI ISS
UniRef100_B9T088UniRef Annotation by Michelle Graham. Most informative UniRef hit: X-ray repair cross complementing protein 3, xrcc3, putative n=1 Tax=Ricinus communis RepID=B9T088_RICCO SoyBaseE_val: 5.00E-115ISS
UniRef100_I1N544UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N544_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g52510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g52510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g288200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g52510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g52510
>Glyma18g52510.1   sequence type=CDS   gene model=Glyma18g52510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGCAGAGAACCTATTGCAATTGCAACACCGCACCCAGAAGTGCACCCTGGGCTGTCCCGTACTCGATCGCTGCCTCGCCGGCGGCGTCCCCTGCGCCTCCGTCACCGAGTTCGTCGGCGAGAGCGGTTGCGGCAAGACGCAGCTCTGCCTCCAACTCGCCCTCTCCGCCCAGCTCCCCCCCTCTCACGGCGGTCTCTCCGCCTCCTCCATCTTCATCCACACCGAGTTCCCCTTCCCCTTCCGCCGCCTCCGCCACCTCTCACGCGCCTTCCGCGCCTCCCACCCCGACCTCCCTTGCTCCGACCCCTGCGACCGCGTCTTCCTACGCGCCGTCCACTCCGCGCACGAATTACTCAACCTAATCCCAACCATCGAGACTTTCCTCTTGCACTCGAAATCGCCGTGGCGGCCGGTGAGAATCATCGTGATCGATTCCATCGCCGCGCTTTTCCGCTCCGATTTCGAGAACACCGGATCGGATCTCCGGCGGAGGTCGTCGCTGTTTTTCGGAATCTCGGGGGGATTGCGGCAGTTGGCGAAGAGGTTTGGGATTGCGGTGGTGGTGACGAACCAGGTTGTGGATTTGATCGGTGATGGTGACGTGAGCTTTGGGAGTTTGGGTAATGGGCTTTATTCTTCGGGCCGAAGGGTTTGTCCTGCGTTGGGCCTGGCTTGGGCCCATTGTGTTAACTCGAGACTGTTTTTGTCGAAGGATGAGGATGAGCCGCCGGTGAAGACAAGGAAAATGAGAGTTGTGTTTGCTCCTCATTTGCCGCACTCTTCTTGCGAGTATGTTATTAAAGGGGAAGGCGTTTTCGGCGTGGAGATGATGCAACACCGAGAAGAAGAGATAAATCTTTGA
Predicted protein sequences of Glyma18g52510
>Glyma18g52510.1   sequence type=predicted peptide   gene model=Glyma18g52510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRAENLLQLQHRTQKCTLGCPVLDRCLAGGVPCASVTEFVGESGCGKTQLCLQLALSAQLPPSHGGLSASSIFIHTEFPFPFRRLRHLSRAFRASHPDLPCSDPCDRVFLRAVHSAHELLNLIPTIETFLLHSKSPWRPVRIIVIDSIAALFRSDFENTGSDLRRRSSLFFGISGGLRQLAKRFGIAVVVTNQVVDLIGDGDVSFGSLGNGLYSSGRRVCPALGLAWAHCVNSRLFLSKDEDEPPVKTRKMRVVFAPHLPHSSCEYVIKGEGVFGVEMMQHREEEINL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo