SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g52461

Feature Type:gene_model
Chromosome:Gm18
Start:61065755
stop:61066146
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g52461
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02500AT Annotation by Michelle Graham. TAIR10: heat shock cognate protein 70-1 | chr5:554055-556334 REVERSE LENGTH=521 SoyBaseE_val: 6.00E-35ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009615GO-bp Annotation by Michelle Graham. GO Biological Process: response to virus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0090332GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal closure SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0002020GO-mf Annotation by Michelle Graham. GO Molecular Function: protease binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR19375Panther HEAT SHOCK PROTEIN 70KDA JGI ISS
PTHR19375:SF1Panther HEAT SHOCK PROTEIN 70-RELATED JGI ISS
PF00012PFAM Hsp70 protein JGI ISS
UniRef100_I1N540UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N540_SOYBN SoyBaseE_val: 8.00E-40ISS
UniRef100_Q9ZSL3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Heat shock protein (Fragment) n=1 Tax=Cichorium intybus RepID=Q9ZSL3_CICIN SoyBaseE_val: 2.00E-35ISS

Expression Patterns of Glyma18g52461
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g52461 not represented in the dataset
Glyma18g52461 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g52461 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g287700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g52461
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g52461
>Glyma18g52461.1   sequence type=CDS   gene model=Glyma18g52461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACAAATGGCAAGACACCTGCGATAGGAATCGATTTGGGCACGACATACTCATGCGTTGCAGTGTGGCGGCATGATCGAGTGGAGATCATCGTGAACGACCAAGGAAACAGAACAACACCCTCTTATGTTGCTTTCAATAACACCCAAAGGATGATTGGTGATGCTGCCAAGAACCAGGCTGCTACCAATCCAACCAACACTGTCTTTGGAAAAATACTAAACCCTTTAGCTTAA
Predicted protein sequences of Glyma18g52461
>Glyma18g52461.1   sequence type=predicted peptide   gene model=Glyma18g52461   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATNGKTPAIGIDLGTTYSCVAVWRHDRVEIIVNDQGNRTTPSYVAFNNTQRMIGDAAKNQAATNPTNTVFGKILNPLA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo