Report for Sequence Feature Glyma18g52450
Feature Type: gene_model
Chromosome: Gm18
Start: 61052769
stop: 61057828
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g52450
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G59840 AT
Annotation by Michelle Graham. TAIR10: Ras-related small GTP-binding family protein | chr5:24107450-24109049 REVERSE LENGTH=216
SoyBase E_val: 7.00E-142 ISS
GO:0007264 GO-bp
Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction
SoyBase N/A ISS
GO:0015031 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein transport
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0005525 GO-mf
Annotation by Michelle Graham. GO Molecular Function: GTP binding
SoyBase N/A ISS
KOG0078
KOG
GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins
JGI ISS
PTHR24073 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24073:SF232 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00071 PFAM
Ras family
JGI ISS
UniRef100_Q41024 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Pisum sativum RepID=Q41024_PEA
SoyBase E_val: 1.00E-148 ISS
UniRef100_UPI00019AA8E9 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00019AA8E9 related cluster n=1 Tax=unknown RepID=UPI00019AA8E9
SoyBase E_val: 1.00E-157 ISS
Expression Patterns of Glyma18g52450
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma18g52450
Paralog Evidence Comments
Glyma02g10450 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g52450 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g287600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g52450
Coding sequences of Glyma18g52450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g52450.1 sequence type=CDS gene model=Glyma18g52450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGCACCACCTGCGAGGGCACGTGCCGATTACGATTACCTCATCAAGCTTCTTCTTATTGGCGATAGCGGTGTGGGAAAGAGTTGTCTGCTTTTGCGATTTTCTGATGGTTCCTTCACAACCAGTTTTATCACCACCATTGGCATTGATTTTAAGATAAGAACCATTGAACTTGATGGCAAACGCATTAAGTTACAAATCTGGGATACAGCTGGTCAGGAGCGATTTCGAACTATTACCACAGCTTATTACCGTGGAGCCATGGGTATCTTGCTCGTTTATGATGTTACTGATGAAGCATCTTTCAACAATATTAGAAATTGGATTCGCAACATTGAACAACATGCTTCTGACAATGTAAACAAGATACTTGTGGGTAACAAGGCTGATATGGATGAAAGTAAAAGGGCTGTGCCTACCTCCAAAGGTCAAGCCCTTGCTGATGAGTATGGTATCAAGTTTTTCGAAACCAGTGCAAAGACAAACATGAATGTGGAGGAGGTTTTCTTTTCAATAGCAAGAGATATCAAGCAAAGGCTTGCTGACACAGATTCTAAGGCTGAACCTCAGACTATCAAGATTAACCAACCCGACCAGACAGCTACAGGGGGTCTTGCGGCTCAAAAATCGGCTTGCTGTGGTTCATGA
Predicted protein sequences of Glyma18g52450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g52450.1 sequence type=predicted peptide gene model=Glyma18g52450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEASFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNMNVEEVFFSIARDIKQRLADTDSKAEPQTIKINQPDQTATGGLAAQKSACCGS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
