Glyma18g52330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g52330

Feature Type:	gene_model
Chromosome:	Gm18
Start:	60967958
stop:	60968725
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Expression Patterns of Glyma18g52330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g52330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g52330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g52330

Limit To All Plant Sequences

>Glyma18g52330.1   sequence type=CDS   gene model=Glyma18g52330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCTGCTTTGTTTGGAGTTTGGTAGAGACCGTTACATGTCTGGGACATAAAATACCAAGAGTGAGTCTGATAAATATGGGTTTCCCATGTTTTATGATAAAATCTCTTGAAAGGTGTCCATCGTTGCCCAATAATATGCTGTTATTATTTGAGCTACATCTGGACTCCACACGTAAAACTTCTGCTCCTCCGTCTCTCTTGTGCCCTTTTTTTACCTTAGAAATTGTAAAAGGAGAGTCATATATTAGTCTCAAGTAG

Predicted protein sequences of Glyma18g52330

Limit To All Plant Sequences

>Glyma18g52330.1   sequence type=predicted peptide   gene model=Glyma18g52330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VCFVWSLVETVTCLGHKIPRVSLINMGFPCFMIKSLERCPSLPNNMLLLFELHLDSTRKTSAPPSLLCPFFTLEIVKGESYISLK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain