Glyma18g51690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g51690

Feature Type:	gene_model
Chromosome:	Gm18
Start:	60510494
stop:	60512893
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g51690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G29400	AT	Annotation by Michelle Graham. TAIR10: MEI2-like protein 5 \| chr1:10290393-10293696 REVERSE LENGTH=800	SoyBase	E_val: 5.00E-45	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0045836	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of meiosis	SoyBase	N/A	ISS
GO:0045927	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
PF04059	PFAM	RNA recognition motif 2	JGI		ISS
UniRef100_E5GB57	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding protein n=1 Tax=Cucumis melo subsp. melo RepID=E5GB57_CUCME	SoyBase	E_val: 3.00E-46	ISS
UniRef100_I1N4X8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N4X8_SOYBN	SoyBase	E_val: 7.00E-126	ISS

Expression Patterns of Glyma18g51690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g51690

Paralog	Evidence	Comments
Glyma08g28860	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g51690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g51690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g51690

Limit To All Plant Sequences

>Glyma18g51690.1   sequence type=CDS   gene model=Glyma18g51690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGAGATGATACTATCAGGAAGAGGCTAAAGGTTGAGCTAAGCCGATCTGAAGACTCAAAACAGAGAAGCTGCAGACATGAAGGCTTATCAAACTTGGATGACAAGAAACAGTATACATCCAAGATGCTGTTAGCTGCAATTGATGAGTGCCATAGAGGAACTTATGATTTTAACAATGGCAATGTGGGATATGCATTCATCAACATGATCAATCCTGGCTTGATTATACTATTCTATCAGGTGTTCAATGGGAAGAAATGGGAGAAATTCAACAGTGAGAAAGTGGCATCACTAGCATATGCTCGCATACAAGGGAAAGCAGCTCTCATTGCTCACTTCCAAAATTCAAGCTTGATGAATGAGGATAAGCACTGCAAGCCTATATCCTCTTCAACGCCGATGGCCCTAATGCCAGTGATCAGAATCTTGGCAAGCCATTTGAAATTTGCACTTCTCTTTTTACCAAGAGATGAAGCTACAAAATGGTTGGCATTAACATTCGCAACAAAGTTGGAAGAGTGA

Predicted protein sequences of Glyma18g51690

Limit To All Plant Sequences

>Glyma18g51690.1   sequence type=predicted peptide   gene model=Glyma18g51690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RDDTIRKRLKVELSRSEDSKQRSCRHEGLSNLDDKKQYTSKMLLAAIDECHRGTYDFNNGNVGYAFINMINPGLIILFYQVFNGKKWEKFNSEKVASLAYARIQGKAALIAHFQNSSLMNEDKHCKPISSSTPMALMPVIRILASHLKFALLFLPRDEATKWLALTFATKLEE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain