SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g51680

Feature Type:gene_model
Chromosome:Gm18
Start:60498749
stop:60502923
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g51680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13330AT Annotation by Michelle Graham. TAIR10: related to AP2 6l | chr5:4272384-4274461 FORWARD LENGTH=212 SoyBaseE_val: 5.00E-42ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0010260GO-bp Annotation by Michelle Graham. GO Biological Process: organ senescence SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0071497GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to freezing SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7KSW4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor n=1 Tax=Medicago truncatula RepID=G7KSW4_MEDTR SoyBaseE_val: 4.00E-67ISS
UniRef100_I1KWQ9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KWQ9_SOYBN SoyBaseE_val: 1.00E-85ISS

Expression Patterns of Glyma18g51680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g51680
ParalogEvidenceComments
Glyma08g28835 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g51680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g281400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g51680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g51680
>Glyma18g51680.1   sequence type=CDS   gene model=Glyma18g51680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGAAATGGTTTCTGCTCTTGCTCAAGTTATGGGAACTACCAATCGGAACCCATACATGCCACAATCAACCTCCTTTCCTTTCTCAACTTCCGTGGTCAAAGATCAACCTCAACCGTACCCATCTCAACCTCCTCCAGATCAAGAGGTGGCAAAGAAGCCACACTACAGAGGAGTGAGGCAGAGACCATGGGGGAAATGGGCAGCAGAAATCCGTGACCCAAAAAAAGCAGCCAGAGTGTGGCTAGGAACCTTTGAAACAGCAGAGGATGCAGCACTTGCATATGACAAAGCAGCACTCAAGTTCAAAGGCACAAAAGCTAAGCTCAATTTCCCTGAAAGAGTTCATCAAGATGTTCCCTTTATGCAACAACACCAACAACGTTCATCAAACAGAAACGTTTTTCCCATCCATGCAACTTCCACCACTAGTAGTGCTACTGGGTCTGTTTCTTCTGTTGATGCTGTTGCTCCTCCTTCGTTGTCCACTCATGATCAACATGGCCACCAAGTTTTCCCAAATCTGTATCAATATGCACAGATTCTTTCAAGTGATGATGCACAGTTACCTTATTTCACATCCCATCTTTTCAATCAACAACAACAACAGCAACAGCAACAACCTTTCAATTCTCAATTCTCTAGCACTTTTTCTTCAACCTCATCCTACTTCTACAACCAGCAACAACAATATGATCAACAAGGACATGATCACTCAAACCACTAG
Predicted protein sequences of Glyma18g51680
>Glyma18g51680.1   sequence type=predicted peptide   gene model=Glyma18g51680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSEMVSALAQVMGTTNRNPYMPQSTSFPFSTSVVKDQPQPYPSQPPPDQEVAKKPHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEDAALAYDKAALKFKGTKAKLNFPERVHQDVPFMQQHQQRSSNRNVFPIHATSTTSSATGSVSSVDAVAPPSLSTHDQHGHQVFPNLYQYAQILSSDDAQLPYFTSHLFNQQQQQQQQQPFNSQFSSTFSSTSSYFYNQQQQYDQQGHDHSNH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo