SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g51670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g51670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g51670

Feature Type:gene_model
Chromosome:Gm18
Start:60493957
stop:60497112
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38130AT Annotation by Michelle Graham. TAIR10: Acyl-CoA N-acyltransferases (NAT) superfamily protein | chr2:15978639-15980145 REVERSE LENGTH=190 SoyBaseE_val: 2.00E-103ISS
GO:0001676GO-bp Annotation by Michelle Graham. GO Biological Process: long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0002213GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to insect SoyBaseN/AISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008080GO-mf Annotation by Michelle Graham. GO Molecular Function: N-acetyltransferase activity SoyBaseN/AISS
KOG3139 KOG N-acetyltransferase JGI ISS
PTHR23091Panther N-TERMINAL ACETYLTRANSFERASE JGI ISS
PTHR23091:SF3Panther N-ACETYLTRANSFERASE MAK3 JGI ISS
PF00583PFAM Acetyltransferase (GNAT) family JGI ISS
UniRef100_C6TB04UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=3 Tax=Glycine max RepID=C6TB04_SOYBN SoyBaseE_val: 7.00E-138ISS
UniRef100_G7KXA5UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-acetyltransferase MAK3-like protein n=1 Tax=Medicago truncatula RepID=G7KXA5_MEDTR SoyBaseE_val: 6.00E-117ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g51670 not represented in the dataset

Glyma18g51670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g28810 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g281300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g51670.1   sequence type=CDS   gene model=Glyma18g51670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGAGACGAAGCAGAAACCATGGAGAATGTGGAATTCGATGCTTCTGAGATTGAGTACGTTAGTTACGGTGGCGAGCATCACCTCCCTCTCGTAATGAACCTGGTGGACCAAGAACTCAGCGAACCTTATTCCATCTTCACGTACCGTTACTTCGTCTATCTCTGGCCTCAGCTTTCATTCCTGGCGTTCCACAAGGGTAAATGCGTGGGCACCGTGGTATGTAAGATGGGGGAACACCGTAACACTTTCAGAGGCTACATTGCCATGCTGGTTGTCATCAAGCCCTACAGAGGAAGAGGCATTGCTACGGAGCTTGTTACTAGGTCTATCAAGGTGATGATGGAATCAGGTTGCGAAGAGGTTACATTAGAAGCGGAAGTGACAAATAAAGGAGCACTGGCACTGTATGGTCGCCTTGGCTTTATTAGGGCCAAGCGGCTCTTTCACTACTATTTGAATGGAGTTGATGCTTTCCGTCTGAAACTTTTATTTCCCCGCTCAGAGTTGCACCCATCTCTGCCTATGATGGCAGATAAATACGAGAGCCACATGCAAAGTGATCATGGTGATGCACCATTTAAAGAATGA

>Glyma18g51670.1   sequence type=predicted peptide   gene model=Glyma18g51670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDRDEAETMENVEFDASEIEYVSYGGEHHLPLVMNLVDQELSEPYSIFTYRYFVYLWPQLSFLAFHKGKCVGTVVCKMGEHRNTFRGYIAMLVVIKPYRGRGIATELVTRSIKVMMESGCEEVTLEAEVTNKGALALYGRLGFIRAKRLFHYYLNGVDAFRLKLLFPRSELHPSLPMMADKYESHMQSDHGDAPFKE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo