SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g51643

Feature Type:gene_model
Chromosome:Gm18
Start:60487088
stop:60489022
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G29540AT Annotation by Michelle Graham. TAIR10: RNApolymerase 14 kDa subunit | chr2:12642727-12643828 FORWARD LENGTH=122 SoyBaseE_val: 7.00E-44ISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0009304GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA transcription SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005666GO-cc Annotation by Michelle Graham. GO Cellular Compartment: DNA-directed RNA polymerase III complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
KOG3438 KOG DNA-directed RNA polymerase, subunit L JGI ISS
PTHR13946Panther DNA-DIRECTED RNA POLYMERASE I,II,III JGI ISS
PF01193PFAM RNA polymerase Rpb3/Rpb11 dimerisation domain JGI ISS
UniRef100_C6T2I2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2I2_SOYBN SoyBaseE_val: 4.00E-73ISS
UniRef100_G7KSV3UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerases I and III subunit RPAC2 n=1 Tax=Medicago truncatula RepID=G7KSV3_MEDTR SoyBaseE_val: 1.00E-56ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g51643 not represented in the dataset

Glyma18g51643 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g281100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g51643.1   sequence type=CDS   gene model=Glyma18g51643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATATATCTTGTTGTTCCCTTCCCAGTTCCTAGCCCTTCGCCGCCGCAGCATCCGAATTCCTTTGATCGTTGGTGTGGAGCGATGGAACACGGCTCATACACTGATCAGAGTAAATCAACATTTAGTCTCGTAGATGAGGATCATACTTTTGCAAACGCTGTTAGATTCACCTTAAATCAAGACCCAAGAGTGTCATTTTGTGGCTACAGCATTCCTCATCCTTCAGATAATCGTGTTAATATCAGAGTCCAGACAACAGGCGATCCATCACGCGAGGTGTTAAAAGATGCATGTCAAGATCTGATGCTTATGTGCCAGCATGTTAGGAGCACTTTTGATAAGGCAGTCAGTGATTTTAAAATCAGCAAGGCTAGGAAGAATAATGAGGATATGGATGTCGAGTAA

>Glyma18g51643.1   sequence type=predicted peptide   gene model=Glyma18g51643   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIYLVVPFPVPSPSPPQHPNSFDRWCGAMEHGSYTDQSKSTFSLVDEDHTFANAVRFTLNQDPRVSFCGYSIPHPSDNRVNIRVQTTGDPSREVLKDACQDLMLMCQHVRSTFDKAVSDFKISKARKNNEDMDVE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo