Report for Sequence Feature Glyma18g51470
Feature Type: gene_model
Chromosome: Gm18
Start: 60346021
stop: 60346594
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g51470
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1N4W0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4W0_SOYBN
SoyBase E_val: 5.00E-36 ISS
Expression Patterns of Glyma18g51470
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g51470
Paralog Evidence Comments
Glyma08g28571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g51470 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g279700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g51470
Coding sequences of Glyma18g51470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g51470.1 sequence type=CDS gene model=Glyma18g51470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGATGCTGGGTTTGGGAAGGCTTGTAGTGACTCTAAAATCCAAAATAAGGTCTTTGAAACTGAAGAAACCTTACGATAAGATGGAGAAGAGTGACAGCATGAGAGTGGAGATAAGAAGCAGGAAGGCCAGAAAGCTTATTGAAGAGACCCTCAAAATTGCTGATTCACCTAAGTCCAAAACCTTCAACTTATGA
Predicted protein sequences of Glyma18g51470
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g51470.1 sequence type=predicted peptide gene model=Glyma18g51470 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVMLGLGRLVVTLKSKIRSLKLKKPYDKMEKSDSMRVEIRSRKARKLIEETLKIADSPKSKTFNL*