SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g51375

Feature Type:gene_model
Chromosome:Gm18
Start:60289700
stop:60290582
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53820AT Annotation by Michelle Graham. TAIR10: Late embryogenesis abundant protein (LEA) family protein | chr5:21853475-21853866 FORWARD LENGTH=67 SoyBaseE_val: 6.00E-21ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009830GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall modification involved in abscission SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7IT15UniRef Annotation by Michelle Graham. Best UniRef hit: Pollen coat-like protein n=1 Tax=Medicago truncatula RepID=G7IT15_MEDTR SoyBaseE_val: 2.00E-23ISS
UniRef100_G7IT15UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pollen coat-like protein n=1 Tax=Medicago truncatula RepID=G7IT15_MEDTR SoyBaseE_val: 2.00E-23ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g51375 not represented in the dataset

Glyma18g51375 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g278700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g51375.1   sequence type=CDS   gene model=Glyma18g51375   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCTCAGAAGGCAAGCTACAACGCTGGAGTGACCAAGGGCCAAACTCAGGAAAAGGCCAGCAACATGATGGACAAAGCTTCTAATACTGCTCAGTCAGCAAAAGACTCCATGCAAGAGACTGGTCAACAGTTGAAGGCCAAGGCACAAGGAGCTGCTGATGCTGTGAAGGATGCAGTGAACAAGTGA

>Glyma18g51375.1   sequence type=predicted peptide   gene model=Glyma18g51375   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSQKASYNAGVTKGQTQEKASNMMDKASNTAQSAKDSMQETGQQLKAKAQGAADAVKDAVNK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo