Report for Sequence Feature Glyma18g51280
Feature Type: gene_model
Chromosome: Gm18
Start: 60212524
stop: 60213285
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g51280
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G25760 AT
Annotation by Michelle Graham. TAIR10: glutamine dumper 2 | chr4:13116149-13116538 FORWARD LENGTH=129
SoyBase E_val: 4.00E-22 ISS
GO:0080143 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of amino acid export
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_Q9SW07 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Protein GLUTAMINE DUMPER 2 n=1 Tax=Arabidopsis thaliana RepID=GDU2_ARATH
SoyBase E_val: 2.00E-19 ISS
UniRef100_UPI000233F3E8 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233F3E8 related cluster n=1 Tax=unknown RepID=UPI000233F3E8
SoyBase E_val: 3.00E-83 ISS
Expression Patterns of Glyma18g51280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g51280
Paralog Evidence Comments
Glyma08g28280 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g51280 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g277600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g51280
Coding sequences of Glyma18g51280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g51280.2 sequence type=CDS gene model=Glyma18g51280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGGCCAATAAACAGTGTATCACCATCATCACCAATGCGTGCCAGTGGGGTTAATATATGGAAGTCTCCAATTCCTTACTTGTTTGGAGGCTTAGCTGTGATGCTGGCTATCATATCTATGGCATTGGTGATCCTTGTTTGCTCATACAGAAAACGTGATTCTCAGTCATCATCTGAAGTTAATGAAGACGTGAAATCACAAGCAATGGCCAACAATTTAGAGACAAACTCAGAACCTGAGGTTCTTGTCATAATGGCTGGTGATCACAACCCCACATACCTTGCAAAACCAATCACTTCTTCAATTTTCTGCACGTGTGGGGCTCAACCAAGTGAACCAAACCCTTCATCAACCTCAACACCCGAGTGA
Predicted protein sequences of Glyma18g51280
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g51280.2 sequence type=predicted peptide gene model=Glyma18g51280 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MRPINSVSPSSPMRASGVNIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSSEVNEDVKSQAMANNLETNSEPEVLVIMAGDHNPTYLAKPITSSIFCTCGAQPSEPNPSSTSTPE*