Glyma18g51250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g51250

Feature Type:	gene_model
Chromosome:	Gm18
Start:	60194258
stop:	60195201
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g51250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G30530	AT	Annotation by Michelle Graham. TAIR10: basic leucine-zipper 42 \| chr3:12139512-12140033 FORWARD LENGTH=173	SoyBase	E_val: 3.00E-49	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0042803	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein homodimerization activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
GO:0046982	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PTHR22952	Panther	CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED	JGI		ISS
PTHR22952:SF64	Panther	ATBZIP3 (ARABIDOPSIS THALIANA BASIC LEUCINE-ZIPPER	JGI		ISS
PF00170	PFAM	bZIP transcription factor	JGI		ISS
UniRef100_I1N4U0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4U0_SOYBN	SoyBase	E_val: 4.00E-141	ISS
UniRef100_Q0GPH3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BZIP transcription factor bZIP73A n=1 Tax=Glycine max RepID=Q0GPH3_SOYBN	SoyBase	E_val: 2.00E-138	ISS

Expression Patterns of Glyma18g51250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g51250

Paralog	Evidence	Comments
Glyma08g28220	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g51250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g277100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g51250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g51250

Limit To All Plant Sequences

>Glyma18g51250.1   sequence type=CDS   gene model=Glyma18g51250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGCCAGGGAGATCACAGGACTCAATTATTTACTCCCTTCAGACCCTTGTCCTTACCCTGGTCACTACAGCATGGTTCAGAACACCATCCCCACATTTCAACTCCACAAACTCTCAAACCAATTCTATGGTTTGCAGAATCCTCCTAAAGTGCTTGCAGACTTCAGCCCCCCTCAGTCCTCATGCATCAGCAGCAACTCAACCTCTGATGAAGCAGATGAGCAGCAGCAAAGCCTCATCAATGAGAGGAAGCACAGGAGGATGATATCGAACCGCGAGTCGGCGCGCCGGTCACGCATGAGGAAGCAGAAACACCTTGATGAACTGTGGTCACAGGTGGTTTGGCTCAGGAATGAAAACCACCAGCTAATGGACAAGCTGAACCATGTGTCTGCGTCACAAGATAAAGTTGTTCAAGAGAATGTTCAGCTGAGAGAAGAAGCCTCAGAACTTCGCCAAATGATATGTGACATGCAGCTACACAGTCCATACCACCCTCCTCCCTTGAGTCCCATTGATGATGATGTTTCTCCCTATGTCAAATCTGATTCCTCAATCACAGACTCTTTGGACCTGCTTGGTTGA

Predicted protein sequences of Glyma18g51250

Limit To All Plant Sequences

>Glyma18g51250.1   sequence type=predicted peptide   gene model=Glyma18g51250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQAREITGLNYLLPSDPCPYPGHYSMVQNTIPTFQLHKLSNQFYGLQNPPKVLADFSPPQSSCISSNSTSDEADEQQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSASQDKVVQENVQLREEASELRQMICDMQLHSPYHPPPLSPIDDDVSPYVKSDSSITDSLDLLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain