|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G32090 | AT | Annotation by Michelle Graham. TAIR10: Beta-1,3-N-Acetylglucosaminyltransferase family protein | chr4:15509990-15510820 REVERSE LENGTH=124 | SoyBase | E_val: 3.00E-14 | ISS |
| GO:0006486 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein glycosylation | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0008378 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity | SoyBase | N/A | ISS |
| UniRef100_I1N4T0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4T0_SOYBN | SoyBase | E_val: 2.00E-84 | ISS |
| UniRef100_Q2R3F9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: LGC1, putative n=3 Tax=Oryza sativa RepID=Q2R3F9_ORYSJ | SoyBase | E_val: 1.00E-19 | ISS |
|
Glyma18g51150 not represented in the dataset |
Glyma18g51150 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.18g276100 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g51150.1 sequence type=CDS gene model=Glyma18g51150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCTCAATTTTCAAGCTTCTCTCCCTGATTCTTTTTCTTGGTTTAGTTTTTCAAGGTGTTGCAGCAAATTGTCCCATTGAGGGGAGATTTAGCATTAGCCAATCACAAACACCAGACTGGGCACATGGCATGCCACAATGGAAAGTGAAAGTCACTAACAAATGTGCGTGTGCTCAATCACAAGTGAAGTTGAACTGCAGTGAATTTCAAACAAATTTTGTTGAGAACCCATCAATTTTGAACATTTCTGGCAATGTGTGTCTTCTAAAAAACGGTCTTCCCATTGGTATAGGTGAAACTGTAGAGTTTTTGTATGCATGGCTTCCTAAGTTTCCATTTCAACCCATTTCTTCTATAGGAGATTGCAACTAA
>Glyma18g51150.1 sequence type=predicted peptide gene model=Glyma18g51150 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MASIFKLLSLILFLGLVFQGVAANCPIEGRFSISQSQTPDWAHGMPQWKVKVTNKCACAQSQVKLNCSEFQTNFVENPSILNISGNVCLLKNGLPIGIGETVEFLYAWLPKFPFQPISSIGDCN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||