SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g50950

Feature Type:gene_model
Chromosome:Gm18
Start:59945582
stop:59945838
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g50950
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_I1N4R2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4R2_SOYBN SoyBaseE_val: 1.00E-27ISS

Expression Patterns of Glyma18g50950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g50950 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma18g50945 Wm82.a1.v1.1IGC Correspondences based on a combination of genome sequence coordinate overlap (fjoin) and sequence similarity (ungapped blastn)

References for Glyma18g50950
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g50950
>Glyma18g50950.2   sequence type=CDS   gene model=Glyma18g50950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTTGTTTACAAACATGCTACTTAGTTGGAAGTTGGAATATTTCAATTGGAAATCTTCGAAATGGAAAAAGCTAGGATTCAAAAGACATATAATTGGCATGGTAGCATGGCAAACTTCAGGCTACCAAATACCAAGATTCTTGTTATGA
Predicted protein sequences of Glyma18g50950
>Glyma18g50950.2   sequence type=predicted peptide   gene model=Glyma18g50950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLFTNMLLSWKLEYFNWKSSKWKKLGFKRHIIGMVAWQTSGYQIPRFLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo