SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g50945

Feature Type:gene_model
Chromosome:Gm18
Start:59943943
stop:59950442
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g50945
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38895AT Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr5:15572084-15573315 FORWARD LENGTH=221 SoyBaseE_val: 4.00E-92ISS
GO:0000303GO-bp Annotation by Michelle Graham. GO Biological Process: response to superoxide SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006914GO-bp Annotation by Michelle Graham. GO Biological Process: autophagy SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009743GO-bp Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010286GO-bp Annotation by Michelle Graham. GO Biological Process: heat acclimation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR22766Panther RING FINGER PROTEIN 24-RELATED JGI ISS
PTHR22766:SF20Panther SUBFAMILY NOT NAMED JGI ISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_B7FJQ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING finger protein n=1 Tax=Medicago truncatula RepID=B7FJQ8_MEDTR SoyBaseE_val: 1.00E-128ISS
UniRef100_C6TGF4UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TGF4_SOYBN SoyBaseE_val: 3.00E-165ISS

Expression Patterns of Glyma18g50945
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g50945 not represented in the dataset
Glyma18g50945 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g50945
ParalogEvidenceComments
Glyma08g27730 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g50945 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g274000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g50945
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g50945
>Glyma18g50945.1   sequence type=CDS   gene model=Glyma18g50945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCTGTTTGTTGCTGTTTCAATGTTGATGATTTTGAAGATTTTATGAATCCAAATAGTTCTGTATATAGGAACTGTATGTGTCTCAGTTGCTTTGTACAGAACTTTTTCACTATGTATGAATCAATATTCCGTAGAGGGGAAGTGCATGCGATTCCTTCATCTATACAGGGCGCAGCATCTATGACTTCTACAGCTTCACTTGATAATTCTCTATCTGACATGTACCGTTCTCCTCCAAGGCCCCTGCCTTATGATGCAGACAGGTTTTTCCGTTCACAGCGTGATGGACTAGTGTCAAGACGTGAGAAGGGTTCAAGTCATTTGAATGAAGAGTCAGAACCTCTAAGAGGTGATGTAGATGCTGACTCAGAATCTTTAAATTCTGCTGGTAAATGGAATGATACCAGTGAAGATGGATCAAAGGAATACCGTTCTAAGTCCACTGTAAGGCTCTCATCAGCAAAACTTACAACTGGAGCTGGGGTTGTCTATTCATCATCAGAAGAGGAGGATGTCTGTCCAACTTGTCTTGAAGAATACACTGAAGAGAATCCGAAGATAGTGACAAAATGCTCTCATCATTTTCATCTTTGTTGTATTTATGAGTGGATGGAAAGAAGTGACAACTGTCCCGTTTGTGGGAAGGTGATGGTATTTGATGAAACGACTGATTGA
Predicted protein sequences of Glyma18g50945
>Glyma18g50945.1   sequence type=predicted peptide   gene model=Glyma18g50945   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAVCCCFNVDDFEDFMNPNSSVYRNCMCLSCFVQNFFTMYESIFRRGEVHAIPSSIQGAASMTSTASLDNSLSDMYRSPPRPLPYDADRFFRSQRDGLVSRREKGSSHLNEESEPLRGDVDADSESLNSAGKWNDTSEDGSKEYRSKSTVRLSSAKLTTGAGVVYSSSEEEDVCPTCLEEYTEENPKIVTKCSHHFHLCCIYEWMERSDNCPVCGKVMVFDETTD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo