SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g50813

Feature Type:gene_model
Chromosome:Gm18
Start:59840396
stop:59842675
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g50813
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28680AT Annotation by Michelle Graham. TAIR10: Malectin/receptor-like protein kinase family protein | chr5:10719437-10722013 REVERSE LENGTH=858 SoyBaseE_val: 2.00E-40ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016324GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apical plasma membrane SoyBaseN/AISS
GO:0090404GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube tip SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_Q69F86UniRef Annotation by Michelle Graham. Best UniRef hit: Serine-threonine kinase n=1 Tax=Phaseolus vulgaris RepID=Q69F86_PHAVU SoyBaseE_val: 5.00E-89ISS
UniRef100_Q69F86UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine-threonine kinase n=1 Tax=Phaseolus vulgaris RepID=Q69F86_PHAVU SoyBaseE_val: 5.00E-89ISS

Expression Patterns of Glyma18g50813
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g50813 not represented in the dataset
Glyma18g50813 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g50813 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g272600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g50813
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g50813
>Glyma18g50813.1   sequence type=CDS   gene model=Glyma18g50813   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAATGGATCTCTTGATGAACTTCTGCGAAGCGGGATACTGTGATAGAAGAAAAATGTTAACTCGTCCCTGTTATAAAAAGGAAAAGAAGATATGCATAGGAGCCGCGCGCGGACTACACTACCTTCACGCTGGAGCCAAGCGCACCATCATTCATCCTCACATCAAACCCAGCAACATTCTTTTGGATGATAACATGGAGCCAAAACTCGCAGGTTTCGACCTTAGCATACAGGGAGCACATTTTATGTCAAAGCCAAAACTAATTCAAGTGCCTGCTGCGGGTACTTATGGCTACTTAGCTATGGAGGTTTGGACAGATAATACCGTCACAGGTAAAACTGATGTTTACTCATTTGGTATGGTTCTACTAGAAGTTGTGTGTGGAAGGAAGTACTTAATGGAGCCAATTGAAACGGAATTTCTGGAAAAACCTCTTGAGGAGAAAATTGATGAAATTATCAAAGGAAGTATCGGACCAGAGTGTTGGCAAGTCTTTGTAGATATCACCCTCAGATGTGTGAAGTTGGAACCAGATGAGCGACCAACAATGGGTGAAGTAGAGGTGGAACTTGAGTTTGCTCTGTCCTTGCAAAAACAAGCAGATAGAGCAAGATATTCCTTATTTTCCACCACCATTATTCCCCCCCCTTTCTCCTTATTCCGGCTTCCTGGGACCTGA
Predicted protein sequences of Glyma18g50813
>Glyma18g50813.1   sequence type=predicted peptide   gene model=Glyma18g50813   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSMDLLMNFCEAGYCDRRKMLTRPCYKKEKKICIGAARGLHYLHAGAKRTIIHPHIKPSNILLDDNMEPKLAGFDLSIQGAHFMSKPKLIQVPAAGTYGYLAMEVWTDNTVTGKTDVYSFGMVLLEVVCGRKYLMEPIETEFLEKPLEEKIDEIIKGSIGPECWQVFVDITLRCVKLEPDERPTMGEVEVELEFALSLQKQADRARYSLFSTTIIPPPFSLFRLPGT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo