SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g50780

Feature Type:gene_model
Chromosome:Gm18
Start:59796619
stop:59799225
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02230AT Annotation by Michelle Graham. TAIR10: reversibly glycosylated polypeptide 1 | chr3:415463-417304 FORWARD LENGTH=357 SoyBaseE_val: 0ISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0033356GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-L-arabinose metabolic process SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0071669GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization or biogenesis SoyBaseN/AISS
GO:0000138GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi trans cisterna SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005795GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi stack SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0030054GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell junction SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008466GO-mf Annotation by Michelle Graham. GO Molecular Function: glycogenin glucosyltransferase activity SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0016760GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity SoyBaseN/AISS
GO:0016866GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity SoyBaseN/AISS
GO:0052691GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-arabinopyranose mutase activity SoyBaseN/AISS
PF03214PFAM Reversibly glycosylated polypeptide JGI ISS
UniRef100_I1N4P7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1N4P7_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q69F96UniRef Annotation by Michelle Graham. Most informative UniRef hit: Reversibly glycosylated protein n=1 Tax=Phaseolus vulgaris RepID=Q69F96_PHAVU SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g27590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g272200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g50780.1   sequence type=CDS   gene model=Glyma18g50780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCCCCCACTCGTGCCGAAAACAGCGGTCTCGCACGTGCCACCCATTTATATTATACCCCATCACAAACTCCCTCTCTCCCTCTGCATCTTCAAACACAACACACACACTGTGTTTGTGAAACTCTCTCTCACACACAAGTCACAAAAACAACTTGTGTTGTTCCAATGGCATCAGCAACACCCCTTTTGAAAGATGAGCTCGACATCGTGATCCCCACGATCAGGAATCTGGATTTCTTGGAGATGTGGAGGCCATTCTTTGAGCCTTACCATCTCATAATTGTGCAAGATGGTGACCCTTCAAAGACCATCAAGGTCCCTGAAGGCTTTGACTATGAGCTCTACAACCGCAATGACATCAACAGGATCCTTGGCCCCAAGGCCAATTGCATCTCCTTCAAGGACTCTGCATGCCGTTGCTTTGGCTACATGGTCTCCAAAAAGAAGTACATCTACACCATTGATGATGACTGCTTTGTTGCCACTGATCCATCTGGACACAAGATTAATGCACTTAAACAGCATATAGAAAACCTCCTCTGTCCATCCACACCCTTTTTTTTCAACACCCTCTATGAACCTTTCCGAGAAGGTGCAGATTTTGTTCGTGGTTACCCTTTCAGTCTCCGGGAAGGTGTACCAACTGCAGTTTCTCATGGTCTTTGGCTCAACATCCCAGACTACGATGCTCCTACCCAGCTTGTGAAGCCTCTTGAGAGGAACACTAGGTATGTGGATGCTGTTTTGACCATACCAAAGGGCACTTTGTTTCCCATGTGTGGAATGAACTTGGCCTTTGATCGTGATCTCATAGGAGCAGCAATGTACTTTGGTCTCATGGGTGATGGTCAGCCTATTGGACGCTACGACGACATGTGGGCTGGCTGGTGCTGCAAGGTAATCTGTGATCACTTGGGATTGGGAATCAAGACTGGTCTGCCCTATATCTATCACAGCAAGGCCAGCAACCCATTTGTGAACTTGAGGAAAGAGTACAAAGGCATATTCTGGCAAGAAGACATTATCCCATTCTTCCAGAGCGTTGTTCTTCCAAAAGAAGCTACCACTGTTCAGAAGTGCTACATTGAGCTTGCCAAGCAAGTCAAGGAAAAGCTTACCAAGGTAGATCCTTACTTTGACAAGTTGGCAGATGCCATGGTCACTTGGATTGAAGCTTGGGATGAGCTTAACCCAGCTGGAGCATCAGTGGCCAATGGCAAAGCATGA

>Glyma18g50780.1   sequence type=predicted peptide   gene model=Glyma18g50780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SPTRAENSGLARATHLYYTPSQTPSLPLHLQTQHTHCVCETLSHTQVTKTTCVVPMASATPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPEGFDYELYNRNDINRILGPKANCISFKDSACRCFGYMVSKKKYIYTIDDDCFVATDPSGHKINALKQHIENLLCPSTPFFFNTLYEPFREGADFVRGYPFSLREGVPTAVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRDLIGAAMYFGLMGDGQPIGRYDDMWAGWCCKVICDHLGLGIKTGLPYIYHSKASNPFVNLRKEYKGIFWQEDIIPFFQSVVLPKEATTVQKCYIELAKQVKEKLTKVDPYFDKLADAMVTWIEAWDELNPAGASVANGKA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo