SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g50750

Feature Type:gene_model
Chromosome:Gm18
Start:59774411
stop:59778644
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g50750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60920AT Annotation by Michelle Graham. TAIR10: COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family | chr5:24511466-24513932 REVERSE LENGTH=456 SoyBaseE_val: 0ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0000272GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process SoyBaseN/AISS
GO:0005982GO-bp Annotation by Michelle Graham. GO Biological Process: starch metabolic process SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010215GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose microfibril organization SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0009897GO-cc Annotation by Michelle Graham. GO Cellular Compartment: external side of plasma membrane SoyBaseN/AISS
GO:0009930GO-cc Annotation by Michelle Graham. GO Cellular Compartment: longitudinal side of cell surface SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF04833PFAM COBRA-like protein JGI ISS
UniRef100_Q69F98UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytochelatin synthetase-like protein n=1 Tax=Phaseolus vulgaris RepID=Q69F98_PHAVU SoyBaseE_val: 0ISS
UniRef100_UPI000233ECC9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ECC9 related cluster n=1 Tax=unknown RepID=UPI000233ECC9 SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g50750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g50750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g271900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g50750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g50750
>Glyma18g50750.1   sequence type=CDS   gene model=Glyma18g50750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTTCTCTCAGTTACCCAAAGCAACTCCTAGCATTTTGTTCTTGGTTCTGCTGTCTTGTACTTGCTTCACTTCAACAGATGCTTATGATCCGCTTGACCCAAATGGGAATATAACAATCAAATGGGATGTTATATCCTGGACCCCTGATGGATATGTAGCTGTTGTTACAATGAACAACTTCCTAGCATTTCGTCACATCCCTTCACCTGGCTGGTCAATGAGATGGACATGGGCCAAAAAGGAGGTAATATGGAACATGGTGGGAGGGCAGGCCACAGAACAAGGGGATTGCTCAAAATTTAAGGGAAATATTCCACATTCCTGTAAGAAAAATCCCACAGTTGTAGATTTGCTTCCTGGAACACCTTACAATCAACAAGTTGCAAATTGCTGCAAAGGTGGAGTGCTCACTACATTGGTGCAGGATCCAACCAAAGCAGCTGCATCATTTCAAGTCAGTGTTGGTAGAGCTGGAACCACAAACAGAACTGTCAAACTCCCAAAAAACTTCACCTTGAAAGCACCGGGACCAGGTTATACTTGTGGGCCAGCTAAGATTGTGAGACCCACTAAATTCATTACTCCAGACAAAAGGAGAGTGACCGTAGCACTGATGACATGGAAAGTGGTATGCACATACTCACAATTTCTGGTTCGTAAAACTCCAACTTGCTGTGTCACACTTTCATCTTTCCATAATAATACTGTTGTGCCCTGCCCAACATGTTCATGTGGCTGCCAAAGGAACTCATCTCGGTCAAGGAGATGTGTAAATCCAGGTACACCACATTTGGCCTCTAACGTTACTAGCTCTGGGACGAATAATTTGTCACCTTTGGTTCAATGTACTAAGCATATGTGCCCAACCCAAGTTCACTGGCACGTTATGCGAAACTCCAAGAAATACTGGCGTGTGAAGGTTACTGTTACTAATTTTAGTTACAGGATGAATTATTCTGACTGGAACTTGCTTGTTCAACACCATAACTTCAACAATCGGACTCAAGTGTTTGGTTTCAACTACAAGTTACTGGCTTTGGATGCATATACAAATGATATAGCAATGCTGTGGGGAATTAAGTCCCGTCATAATGACATTCTCAACCAAGCTGGCCCTAAAGGCAATGTTCAAGCAGAGCTACTCTTCAGAAAGGATAAAGCAACTTTTACTTTTGATAAGGGTTGGGCTTTTCCTCGAAGGATCTACTTCAATGGTGACATATGTGTGATGCCACCACCTGATGCTTATCCATTTTAG
Predicted protein sequences of Glyma18g50750
>Glyma18g50750.1   sequence type=predicted peptide   gene model=Glyma18g50750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGFSQLPKATPSILFLVLLSCTCFTSTDAYDPLDPNGNITIKWDVISWTPDGYVAVVTMNNFLAFRHIPSPGWSMRWTWAKKEVIWNMVGGQATEQGDCSKFKGNIPHSCKKNPTVVDLLPGTPYNQQVANCCKGGVLTTLVQDPTKAAASFQVSVGRAGTTNRTVKLPKNFTLKAPGPGYTCGPAKIVRPTKFITPDKRRVTVALMTWKVVCTYSQFLVRKTPTCCVTLSSFHNNTVVPCPTCSCGCQRNSSRSRRCVNPGTPHLASNVTSSGTNNLSPLVQCTKHMCPTQVHWHVMRNSKKYWRVKVTVTNFSYRMNYSDWNLLVQHHNFNNRTQVFGFNYKLLALDAYTNDIAMLWGIKSRHNDILNQAGPKGNVQAELLFRKDKATFTFDKGWAFPRRIYFNGDICVMPPPDAYPF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo