SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g50595): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g50595): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g50595

Feature Type:gene_model
Chromosome:Gm18
Start:59676735
stop:59681611
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56500AT Annotation by Michelle Graham. TAIR10: TCP-1/cpn60 chaperonin family protein | chr5:22874058-22876966 FORWARD LENGTH=597 SoyBaseE_val: 1.00E-30ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0042026GO-bp Annotation by Michelle Graham. GO Biological Process: protein refolding SoyBaseN/AISS
GO:0044267GO-bp Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11353Panther CHAPERONIN JGI ISS
PTHR11353:SF8Panther RUBISCO SUBUNIT BINDING-PROTEIN BETA SUBUNIT, RUBB JGI ISS
PF00113PFAM Enolase, C-terminal TIM barrel domain JGI ISS
PF00118PFAM TCP-1/cpn60 chaperonin family JGI ISS
UniRef100_P08927UniRef Annotation by Michelle Graham. Most informative UniRef hit: RuBisCO large subunit-binding protein subunit beta, chloroplastic n=1 Tax=Pisum sativum RepID=RUBB_PEA SoyBaseE_val: 4.00E-29ISS
UniRef100_UPI000233F26BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F26B related cluster n=1 Tax=unknown RepID=UPI000233F26B SoyBaseE_val: 2.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g50595 not represented in the dataset

Glyma18g50595 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g270500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g50595.1   sequence type=CDS   gene model=Glyma18g50595   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGTCCCAATTGGAGCAAGCAAATTTGAGGAAGCATTGCGAATGGGCACCGAGACCTATCATCACTTAAAGGTTGAAGCTGATATTGTGAAAAGAGCTCTTAGTTACCCTTTGAAATTAATTGCTAAGAATGCTCGTGTCAATGATAGTGTTGTCAGTGAGAAGGTATTGTCCAGTGACAATCCAGGATATGGATATAATGCTGCCACTGGTAAATATGAAGATCTGATGTCTGCTGGGATCATTGATCCAACAAAGGTGAGAGCAACTGTTGCAGAGCTTCAAAATGTTGTTCGTGTATTTAGTCAGTTGTGTGCTGCTTCCAACCTACATATTCACGGGTTTCATCAAAAGAATGTTGGATACTGCAATTCGATAATCATATTGGCATCCATTTCAGCTCCACCTGCACATAAAGGTCATTTTAGGTTCATGCTTAATTATCTACACTTTCTGTTCAACATTTACATACATAGATAA

>Glyma18g50595.1   sequence type=predicted peptide   gene model=Glyma18g50595   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIVPIGASKFEEALRMGTETYHHLKVEADIVKRALSYPLKLIAKNARVNDSVVSEKVLSSDNPGYGYNAATGKYEDLMSAGIIDPTKVRATVAELQNVVRVFSQLCAASNLHIHGFHQKNVGYCNSIIILASISAPPAHKGHFRFMLNYLHFLFNIYIHR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo