Report for Sequence Feature Glyma18g50570
Feature Type: gene_model
Chromosome: Gm18
Start: 59673531
stop: 59674361
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g50570
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1N4N2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N4N2_SOYBN
SoyBase E_val: 3.00E-77 ISS
Expression Patterns of Glyma18g50570
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g50570
Paralog Evidence Comments
Glyma08g27380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g50570 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g270300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g50570
Coding sequences of Glyma18g50570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g50570.1 sequence type=CDS gene model=Glyma18g50570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGAAGCAAGCATCAACCTTTTTCCTCATGTGGCTTATGGTCATTTCGCTTCAAACACATATCACCATTGCAGCTCTGTCCAAGTCCAATGGCACAATTTCTCTGTGCGATGGCTCCGTGGAGGACTGCCTAAACGTCGACCACTTGGACTCGCAGCTTCCCACCATCTCCAGCTCCCACTTCCGCAGAATCCTCCTTGCAGGCCAAAATACAGGAGGTACACCTGATCCTAATAACCCCGCCATCAAATGTGTGCGAATAGACCGATATGGCAGCTGTCTGCCCCAAGCTGATGGTAAAAAGAGACACTGTGACATAACCAACAGGGGCTGTTGA
Predicted protein sequences of Glyma18g50570
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g50570.1 sequence type=predicted peptide gene model=Glyma18g50570 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKKQASTFFLMWLMVISLQTHITIAALSKSNGTISLCDGSVEDCLNVDHLDSQLPTISSSHFRRILLAGQNTGGTPDPNNPAIKCVRIDRYGSCLPQADGKKRHCDITNRGC*