Report for Sequence Feature Glyma18g50120
Feature Type: gene_model
Chromosome: Gm18
Start: 59337674
stop: 59338706
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g50120
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G65360 AT
Annotation by Michelle Graham. TAIR10: Histone superfamily protein | chr5:26120099-26120509 REVERSE LENGTH=136
SoyBase E_val: 5.00E-94 ISS
GO:0006334 GO-bp
Annotation by Michelle Graham. GO Biological Process: nucleosome assembly
SoyBase N/A ISS
GO:0000786 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleosome
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
KOG1745
KOG
Histones H3 and H4
JGI ISS
PTHR11426 Panther
HISTONE H3
JGI ISS
PF00125 PFAM
Core histone H2A/H2B/H3/H4
JGI ISS
UniRef100_I1K4W0 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Histone H3 n=1 Tax=Glycine max RepID=I1K4W0_SOYBN
SoyBase E_val: 3.00E-92 ISS
UniRef100_I1K4W0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Histone H3 n=1 Tax=Glycine max RepID=I1K4W0_SOYBN
SoyBase E_val: 3.00E-92 ISS
Expression Patterns of Glyma18g50120
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g50120 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g266200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g50120
Coding sequences of Glyma18g50120
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g50120.1 sequence type=CDS gene model=Glyma18g50120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCGTACGAAGCAAACCGCTCGCAAGTCCACCGGTGGCAAGGCGCCACGTAAGCAGCTCGCCACCAAGGCCGCTCGGAAGTCCGCTCCGGCGACCGGAGGAGTGAAGAAGCCCCACCGCTTCAGGCCGGGAACCGTGGCGCTGAGGGAAATCAGAAAGTACCAGAAGAGCACCGAGCTTCTCATCAGGAAGCTTCCGTTTCAGAGGCTCGTGAGAGAAATCGCGCAGGATTTCAAGACCGATTTGCGTTTCCAGAGCAGCGCTGTTTCCGCGCTTCAGGAGGCTGCTGAGGCTTACCTCGTTGGGTTGTTCGAGGACACTAACCTCTGCGCGATTCATGCTAAGAGGGTTACCATTATGCCCAAGGATATCCAGCTTGCACGCAGGATCAGAGGCGAGAGGGCTTAG
Predicted protein sequences of Glyma18g50120
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g50120.1 sequence type=predicted peptide gene model=Glyma18g50120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*