SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g50051

Feature Type:gene_model
Chromosome:Gm18
Start:59296008
stop:59296702
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g50051
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G36130AT Annotation by Michelle Graham. TAIR10: Cytochrome P450 superfamily protein | chr5:14209293-14209811 REVERSE LENGTH=140 SoyBaseE_val: 3.00E-26ISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
UniRef100_B9SAB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450, putative n=1 Tax=Ricinus communis RepID=B9SAB8_RICCO SoyBaseE_val: 3.00E-30ISS
UniRef100_UPI000233EB47UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EB47 related cluster n=1 Tax=unknown RepID=UPI000233EB47 SoyBaseE_val: 2.00E-48ISS

Expression Patterns of Glyma18g50051
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g50051 not represented in the dataset
Glyma18g50051 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g50051
ParalogEvidenceComments
Glyma08g26670 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g50051 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g265600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g50051
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g50051
>Glyma18g50051.1   sequence type=CDS   gene model=Glyma18g50051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATATTCGTGGAATATATCCCAAGGAGCTTTTAGGGAAGCTATAGAGGACTTTGACTTCAATGGATTCTCAATTCCAAAAGCCTGGAAGTTCAACACTCAGAAATCCAGAGTACTTCCCCCAGAGCCAGAGAAATTTGATCCGAGAAGATTAGAAGGAAATGAACCAGCTCCGTATACTTATGTGCCATTTGTGAAGAGGTTCAAGTGTCAAACTGTTATTCCTAATGGGAATATTACGTACAATCCCACGCCTATTCCTGCCAAGGGCCTTCCTGTTCGTCTTATTCCTCAACGATCTTGA
Predicted protein sequences of Glyma18g50051
>Glyma18g50051.1   sequence type=predicted peptide   gene model=Glyma18g50051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKYSWNISQGAFREAIEDFDFNGFSIPKAWKFNTQKSRVLPPEPEKFDPRRLEGNEPAPYTYVPFVKRFKCQTVIPNGNITYNPTPIPAKGLPVRLIPQRS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo