Report for Sequence Feature Glyma18g49720
Feature Type: gene_model
Chromosome: Gm18
Start: 59075417
stop: 59076467
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g49720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_I1N4G3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase n=1 Tax=Glycine max RepID=I1N4G3_SOYBN
SoyBase E_val: 6.00E-12 ISS
UniRef100_I1N4G3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Pectinesterase n=1 Tax=Glycine max RepID=I1N4G3_SOYBN
SoyBase E_val: 6.00E-12 ISS
Expression Patterns of Glyma18g49720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g49720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g262300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g49720
Coding sequences of Glyma18g49720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g49720.1 sequence type=CDS gene model=Glyma18g49720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCATAGACACAGGGATTAAACTTCTTGATAGTATTCCTGACTTCATTTATCTTCTTCTGTTAGCTTATGCTTCAGCAGCTACTTGGTATTGTCTGAACACTTTTTTAATCTGTTACTTTGTTCAAGTCTCCACTATATTAAGAACATTCAAACCAGCAGGAGTGGTGATCTGTCGTTATCTTTTCTACCTGGGGAAAACTCGGACAATTCAGTTGGAAAAATTGCCAGATGAAGAAGCTGAGCAGTTCCTGATGTATCCTTTCATTGATCCAGAACCAGAGAAACCTTGGCTTGCTCAAAGGAGGGCCCTCAGGATTTCATATTCTGCTTGA
Predicted protein sequences of Glyma18g49720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g49720.1 sequence type=predicted peptide gene model=Glyma18g49720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSIDTGIKLLDSIPDFIYLLLLAYASAATWYCLNTFLICYFVQVSTILRTFKPAGVVICRYLFYLGKTRTIQLEKLPDEEAEQFLMYPFIDPEPEKPWLAQRRALRISYSA*