SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g49560

Feature Type:gene_model
Chromosome:Gm18
Start:58935910
stop:58938647
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g49560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48320AT Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein | chr1:17855024-17855577 REVERSE LENGTH=156 SoyBaseE_val: 7.00E-75ISS
GO:0042372GO-bp Annotation by Michelle Graham. GO Biological Process: phylloquinone biosynthetic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0047617GO-mf Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity SoyBaseN/AISS
KOG3328 KOG HGG motif-containing thioesterase JGI ISS
PTHR12418Panther FAMILY NOT NAMED JGI ISS
PTHR12418:SF10Panther JGI ISS
PF03061PFAM Thioesterase superfamily JGI ISS
UniRef100_C6T4X8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T4X8_SOYBN SoyBaseE_val: 2.00E-111ISS
UniRef100_G7IQD5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Esterase ydiI n=1 Tax=Medicago truncatula RepID=G7IQD5_MEDTR SoyBaseE_val: 1.00E-81ISS

Expression Patterns of Glyma18g49560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g49560
ParalogEvidenceComments
Glyma09g37120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g49560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g260800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g49560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g49560
>Glyma18g49560.1   sequence type=CDS   gene model=Glyma18g49560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAACCAGCCCCCATCATCAAAGGCTTCTGAAGTAGATGCCCCCCTTCAATCAATTGGTTTTGAGATTCAAGAATTGTCTCCACAAAGGGTATCTGGCCATCTACCTGTTACTCAAAAGTGCTGTCAGCCATTCAAGGTGTTGCATGGAGGGGTATCAGCATTGGTGGCAGAGTCTCTGGCAAGCATAGGAGCACACATGGCTAGTGGATACCAAAGAGTGGCTGGGATTCAACTCAGCATCAACCATTTGAAAAGTGCTGTGCTTGGTGACTTGGTCTATGCTGAAGCCATCCCTTTAAATGTTGGCAAAACCATTCAGGTATGGGAGGTGAGAATATGGAAGCTTGATCCTTCTAACAAACAAAAGAAAACTCTAGTATCATCATCAAGGGTTACTCTACTGTGCAACATGCCTGTCCCAGATAATGCAAAAGACGCTGGAGACAAACTCAGGAAGCATGCAAGGCTATGA
Predicted protein sequences of Glyma18g49560
>Glyma18g49560.1   sequence type=predicted peptide   gene model=Glyma18g49560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENQPPSSKASEVDAPLQSIGFEIQELSPQRVSGHLPVTQKCCQPFKVLHGGVSALVAESLASIGAHMASGYQRVAGIQLSINHLKSAVLGDLVYAEAIPLNVGKTIQVWEVRIWKLDPSNKQKKTLVSSSRVTLLCNMPVPDNAKDAGDKLRKHARL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo